SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022045 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022045
Domain Number 1 Region: 59-261,306-415
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000053
Family Quinoprotein alcohol dehydrogenase-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022045   Gene: ENSBTAG00000016571   Transcript: ENSBTAT00000022045
Sequence length 552
Comment pep:known chromosome:UMD3.1:25:282554:290839:1 gene:ENSBTAG00000016571 transcript:ENSBTAT00000022045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGKDLEAEIHPLKSENRKVPENAGALAGKEPRGTPAPQTRLSHCRTAAFFLSLFACLL
VVFVVSFIIPCPDRPALQGVWRIDYNAAVAYDFLAAEDVNKDKIQDILFLYKNTNSSRGN
SSFSCADEGFSCPCTFVAAVSGASGSVLWERPVAQDRAFVECGILQPRGSAAPSACVVLG
RPGSLVAVDTLTGKTLWSQPSSFGGNASVLSPLLRVPDLDADGAPDLLVLIQEENQVNGS
IYSGGTGQQVSPPDSLGVDGTSGSILHVTRAGAHYVLIPCGTALCSRSVKGLYEKVSRRD
SPLKSDPLWEDMLSAASHRLVVHSSGAIRYLMNVPGKAGDDLLLVSTEAYMLLDGQDLTP
RWTFGTTQVLRKPVLGYYKPDTPAVLVENGTGPDRQVLLLDLGSGAVLWSQALPGLPGDP
PSASLPTADHRSAFFFWGIHEPTDSNQTEPGAAGRRLYMLHPTLPGVLLELDNVSVPIVA
FQVVLLEPGRHAACILLTGPASPSPPGLVSVTKHKVQDLVLAGRVVHLAEGGAESDQAVR
DRLSRLRYRSEA
Download sequence
Identical sequences Q2HJE5
ENSBTAP00000022045 NP_001068786.1.59421 NP_001068786.1.76553 XP_005201040.1.76553 XP_005201041.1.76553 XP_005201042.1.76553 XP_005201043.1.76553 XP_005201044.1.76553 XP_010799078.1.76553 XP_015331337.1.76553 ENSBTAP00000022045 9913.ENSBTAP00000022045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]