SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022047 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022047
Domain Number 1 Region: 346-649
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.4e-50
Family Rhodopsin-like 0.00056
Further Details:      
 
Domain Number 2 Region: 52-250
Classification Level Classification E-value
Superfamily L domain-like 1.3e-32
Family Ngr ectodomain-like 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022047   Gene: ENSBTAG00000016573   Transcript: ENSBTAT00000022047
Sequence length 701
Comment pep:known chromosome:UMD3.1:11:30823435:30887992:-1 gene:ENSBTAG00000016573 transcript:ENSBTAT00000022047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPSLALRLLLALLLLPPPAPLLWALRPAPCPEPCSCPPDGALRCPGPQAGLSRLSLTY
LPIKVIPSQAFRGLNEVIKIEISQSDSLEKIEANAFDNLLNLSEILIQNTKNLVHIEAGA
FTNLPRLKYLSICNTGIHKLPDVTKIFSSEFNFILEICDNLHITTIPRNAFQGMNNESIT
LKLYGNGFEEIQSHAFNGTTLISLELKENARLEKMHNDAFRGATGPSILDISSTQLQALP
TYGLESIQTLIATSSYSLKKLPSREKFTNLLDATLTYPSHCCAFRNLPTNEQNFSFSIFK
NFSKQCESTARRPNNETLYSAIFAESELSGWDYDYGFCLPKTLQCAPEPDAFNPCEDIMG
YNFLRVLIWLINILAITGNVTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASV
DAQTKGQYYNHAIDWQTGSGCSAAGFFTVFASELSVYTLTVITLERWHTITYAIQLDQKL
RLKHAIPVMLGGWLFSTLIAVLPLVGVSNYMKVSICLPMDVESTLSQVYILTILILNVMA
FIIICACYIKIYFAVQNPELMATNKDTKIAKKMAVLIFTDFTCMAPISFFAISAAFKVPL
ITVTNSKVLLVLFYPVNSCANPFLYAIFTKAFQRDFFLLLSKFGCCKYRAELYRRKDFSA
YISNCKNGFTGSNKPSRSTFKLTTLQCQYSAVLDKTCYKEC
Download sequence
Identical sequences A0A140T893
ENSBTAP00000022047 ENSBTAP00000022047 9913.ENSBTAP00000022047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]