SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022049 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022049
Domain Number 1 Region: 284-587
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 8.97e-50
Family Rhodopsin-like 0.00056
Further Details:      
 
Domain Number 2 Region: 52-229
Classification Level Classification E-value
Superfamily L domain-like 1.33e-28
Family Ngr ectodomain-like 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022049   Gene: ENSBTAG00000016573   Transcript: ENSBTAT00000022049
Sequence length 639
Comment pep:known chromosome:UMD3.1:11:30823435:30888003:-1 gene:ENSBTAG00000016573 transcript:ENSBTAT00000022049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPSLALRLLLALLLLPPPAPLLWALRPAPCPEPCSCPPDGALRCPGPQAGLSRLSLTY
LPIKVIPSQAFRGLNEVIKIEISQSDSLEKIEANAFDNLLNLSEILIQNTKNLVHIEAGA
FTNLPRLKYLSICNTGIHKLPDVTKIFSSEFNFILEICDNLHITTIPRNAFQGMNNESIT
LKLYGNGFEEIQSHAFNGTTLISLELKENARLEKMHNDAFRGATGPSILQNFSFSIFKNF
SKQCESTARRPNNETLYSAIFAESELSGWDYDYGFCLPKTLQCAPEPDAFNPCEDIMGYN
FLRVLIWLINILAITGNVTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDA
QTKGQYYNHAIDWQTGSGCSAAGFFTVFASELSVYTLTVITLERWHTITYAIQLDQKLRL
KHAIPVMLGGWLFSTLIAVLPLVGVSNYMKVSICLPMDVESTLSQVYILTILILNVMAFI
IICACYIKIYFAVQNPELMATNKDTKIAKKMAVLIFTDFTCMAPISFFAISAAFKVPLIT
VTNSKVLLVLFYPVNSCANPFLYAIFTKAFQRDFFLLLSKFGCCKYRAELYRRKDFSAYI
SNCKNGFTGSNKPSRSTFKLTTLQCQYSAVLDKTCYKEC
Download sequence
Identical sequences F1MMH0
ENSBTAP00000022049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]