SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022065 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000022065
Domain Number - Region: 449-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0513
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022065   Gene: ENSBTAG00000016588   Transcript: ENSBTAT00000022065
Sequence length 723
Comment pep:known chromosome:UMD3.1:25:365646:374631:-1 gene:ENSBTAG00000016588 transcript:ENSBTAT00000022065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGTGTGGAAVAVAMSLLLLLLSRSPPAAAGDGRKSDSRLVSEQFSQAPQKLAFYNWY
GSARLFHFRVPPDTVLLHWLLQVTRGSGPTCNNVETTVYFRYGAPPVINPLGTSFANNTS
VQPSFLLRMLQDNASVNVSYPAPGDWFVAAHLPPSSHKIEVKDFIPTCAYIFQPDMLVVR
VVEMSILEPDVHLTVGSATLPGNFQKVLTCSDPTTACRLLLPSPPWERWLQVTAKSLAGP
RVLVTFSAVAALTACRPWTANLQRLLQSSPNQSSNASTGPPPLSPNTQDLDQSGEAGSGA
FCFRSFPILREDMDVVSVRFRPLDRASVLVQSDMPSVMKLHLNTGMDSGGSLSISVSVNQ
TVIASNTSVVACVTAGSPFLSFNTSLNCTTAFFQGYPLSLSASSPTANLSIPYPETDNWY
LSLQVLCPERPEECMQPSVLVETTLYLVPCLNDCGPYGQCLLLRRHGYLYAGCSCRAGWR
GWSCTDNSTAQTLAQQKVATLLLTLSNLMFLAPIAISVHRCLLVEASVYAYTMFFSTFYH
ACDQPGDAVLCILNYDTLQYCDFLGSGVSIWVTVLCMARLKASLKYVLFILGALVFAMSL
QLDRRAAWNTTGPCLFAIVVMVTMWVYRCGRRRHCYPPSWQRWVFYLLPGLSMAALALTI
YVSMMTSENYYYTHSIWHMLLAGSAAFLLPPREQHAEPWACAQKLTCHYEICKNHRDELY
TVT
Download sequence
Identical sequences A6H6Z1
ENSBTAP00000022065 NP_001092377.1.59421 NP_001092377.1.76553 ENSBTAP00000022065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]