SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022102 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022102
Domain Number 1 Region: 468-652
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-44
Family cAMP-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 251-464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-33
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.2e-19
Family Flavin-binding PAS domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022102   Gene: ENSBTAG00000016613   Transcript: ENSBTAT00000022102
Sequence length 905
Comment pep:known_by_projection chromosome:UMD3.1:19:48490643:48513425:1 gene:ENSBTAG00000016613 transcript:ENSBTAT00000022102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPRSAMSRLAQALLGAEECKVDILYYRKDASCFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKRGSRSLSQRLLRQSFLGSDGSHGRSGAQGPGAGRVKYRTISQ
IPQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTLLHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESQRGDCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACICS
LTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVK
EFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCP
AFHGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGK
NDIFGEPVSLHARPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFN
LRDAGGGLQSSPQQAPGSQDHQQGFFLSDNQSGAAPSLSISDASGLWPELLQQVPPRPNQ
SPQNPQGDSDCWPRELGSRLEQLQAQMNRLESRMSSDLSRILKLLQQPLPQDHTGYILGA
STSNDLALFPATSATQSPGTRLPRGDPPPAQMPSYGDMDEWRPELRNSSSRMPPSAVEMD
RTLTLSSEQKQPEGLLSPLASPLCPLEVQGLVCGPRYPSLPEHLSSVPKQLEFQRHGSDP
GFSRS
Download sequence
Identical sequences E1BMA2
NP_001178323.1.59421 NP_001178323.1.76553 ENSBTAP00000022102 ENSBTAP00000022102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]