SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022243 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022243
Domain Number 1 Region: 32-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.83e-89
Family L-arabinose binding protein-like 0.0000731
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022243
Domain Number - Region: 493-539
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00494
Family TNF receptor-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022243   Gene: ENSBTAG00000016734   Transcript: ENSBTAT00000022243
Sequence length 841
Comment pep:known_by_projection chromosome:UMD3.1:16:47669655:47677534:-1 gene:ENSBTAG00000016734 transcript:ENSBTAT00000022243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGVRLVGLQLSLSCCWAFSCHNTPSSPDFSLPGDYLLAGMFPLHSALPEARGRPTVT
FCDRSNSFNGHGYHLFQAMRFSIEEINNSTALLPNVTLGYELYDVCSDSANMYATLSILS
TLGRHYVEIQGDPAHFSPAMVAVIGPDITKHALTTAALLSPFLVPLVSYGASSMVLNARR
LYPSFLRTISSDKHQVDILVLLLQRFGWVWISIVGGEGDYGEVGIQELEYQVTRQGICIA
FRDIVPFSARPGDERMQSMIRCLVQARTTVVVVYSGRQLARVFFESVVLAKLTAKVWIAT
EDWAISSHINSVPGIQGIGTVLGMAIPHRHVPGLKEFEEAYVQADKGVLRPCPQGSWCNS
NQLCTECWAFTAQAMPTLAEFSMSSAYNAYQAVYAVAHGLHQLLGCSSGACSRGRVYPWQ
LLEQIRKVKFLLHKDAVTFNDDGNTLSNYDIIAWDWSGPNWTFRVIGSSSPFSVLLDINT
TKIRWHGNDNQVPTSVCSRDCPEGHQRVITGFHHCCFECVPCEAGTFLNKSDPYRCRPCG
KEEWAPERSQTCFPRTVVFLTWHEPVSLVLLAANTLLLLLVAGTAGLFAWHLDTPVVRSA
GGRLCFFMLGSLAGGTWGLYGFFGEPTLPTCLLRQGLFSLGFAIFLSCLTVRSFQLVFIF
KFSARLPTFFRAWVQNRGAGLFVMISSTIQLLICLIWLAVWTPLPTREYKHFPQLVVLGC
TEANSLGFMLAVTYNGLLSISAFACSYLGKDLPENYNEAKCVTFSLLLNFVSWIAFFTMA
IVYQGKYLPAVNALAMLSSLSGGFSGYFLPKCYVILYRPDLNSTEHFQASIQDYTRRCGS
T
Download sequence
Identical sequences E1BPM8
ENSBTAP00000022243 ENSBTAP00000022243 9913.ENSBTAP00000022243 XP_002694212.1.76553 XP_601773.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]