SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022474 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022474
Domain Number 1 Region: 81-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000103
Family Laminin G-like module 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022474   Gene: ENSBTAG00000025324   Transcript: ENSBTAT00000022474
Sequence length 362
Comment pep:known_by_projection chromosome:UMD3.1:10:91597994:92216106:1 gene:ENSBTAG00000025324 transcript:ENSBTAT00000022474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRIHARRNPPRRPAWTLGIWSLFWGCIVSSVWSSSNVASSSSSPGSHSQHEHHFHGSK
HHSVPISIYRSPVSLRGGHAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKD
GILVRIDSAPGLGDFLQLHIRQGELAVVIAFSSVSLQSQTQPHPRESGKNQAFQFSSGSG
DSREKVTSWRTNRTNPLGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAA
ENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQ
PTSDDLVSSAECSSDDEDFVECEPSTARSSNAARSLRAALTWTWRLTYTFTPIIFISCVV
HS
Download sequence
Identical sequences G3X794
ENSBTAP00000022474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]