SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022475 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022475
Domain Number 1 Region: 81-250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000184
Family Laminin G-like module 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022475   Gene: ENSBTAG00000025324   Transcript: ENSBTAT00000022475
Sequence length 426
Comment pep:known_by_projection chromosome:UMD3.1:10:91597994:92223876:1 gene:ENSBTAG00000025324 transcript:ENSBTAT00000022475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRIHARRNPPRRPAWTLGIWSLFWGCIVSSVWSSSNVASSSSSPGSHSQHEHHFHGSK
HHSVPISIYRSPVSLRGGHAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKD
GILVRIDSAPGLGDFLQLHIRQGELAVVIAFSSVSLQSQTQPHPRESGKKHTFQFSSGSG
DSREKVTSWRTNRTNPLGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAA
ENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQ
PTSDDLVSSAECSSDDEDFVECEPSTANPTEPGVRRVPGASEVIRESSSTTGMVVGIVAA
AALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLLKEKPPSSKGGHKKQKNK
DKEYYV
Download sequence
Identical sequences F6RU36
ENSBTAP00000022475 ENSBTAP00000022475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]