SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022558 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022558
Domain Number 1 Region: 396-744
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.53e-87
Family YicI catalytic domain-like 0.0000724
Further Details:      
 
Domain Number 2 Region: 746-828
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.76e-22
Family Putative glucosidase YicI, domain 3 0.0087
Further Details:      
 
Domain Number 3 Region: 88-177,264-393
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.71e-16
Family YicI N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022558   Gene: ENSBTAG00000016956   Transcript: ENSBTAT00000022558
Sequence length 966
Comment pep:known chromosome:UMD3.1:29:41664315:41679641:-1 gene:ENSBTAG00000016956 transcript:ENSBTAT00000022558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIAAVEARRRRSWTALVLACLGVCLGITFAVDRSNFKTCEESSFCKRQRSIRPGHSPY
RALLDSLQLGPDALTVHLINEVTKVVLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
ADPPTAGLSVSGRDDNSVELTVAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLNLEH
QRTPRVSFSDKVSLTLGSIWDRIKNVFSRQGSKEPAEGDGAQPEETPGDDNKPDETQGKP
EHDEPGAWEETFKTHSDSKPYGPTSVSLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYR
LYNLDVFQYELYNRMALYGSVPVLLAHSPLRDLGIFWLNAAETWVDISSNTAGKTLFGKM
LDYLQGSGETPQTDVRWMSESGIIDVFLMLGPSVFDVFRQYASLTGTQALPPLFSLGYHQ
SRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRNMLEHLAS
KRRKLVAIVDPHIKVDSGYRVHEELQNLGLYVKTRDGSDYEGWCWPGAAGYPDFTNPKMR
AWWANMFHFDNYEGSAPNLYVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLY
VHMATADGLVLRSGGIERPFVLSRAFFAGSQRFGAVWTGDNAAEWDHMKISIPMCLSLGL
VGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQYHEIIR
DALGQRYSLLPFWYTLFYQSHREGIPVMRPLWVHYPKDVTTFSIDDQFLLGDALLVHPVS
DSEARGVQVYLPGQGEVWYDVQSYQKYHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRR
SSDCMKDDPITLFVALSLQGTAQGELFLDDGHTFNYQTRHEFLLRRFSFSGNTLVSSSAD
PKGHFETPIWIERVVIIGAGKPATVVLQTKGSPESRLSFQHDPETSVLILRKPGVNVASD
WTIHLR
Download sequence
Identical sequences F1N6Y1
9913.ENSBTAP00000022558 ENSBTAP00000022558 ENSBTAP00000022558 NP_001192706.1.59421 NP_001192706.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]