SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022592 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022592
Domain Number 1 Region: 47-163
Classification Level Classification E-value
Superfamily FKBP-like 6.21e-35
Family FKBP immunophilin/proline isomerase 0.000000449
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000949
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022592   Gene: ENSBTAG00000016988   Transcript: ENSBTAT00000022592
Sequence length 163
Comment pep:known chromosome:UMD3.1:7:15532998:15545250:1 gene:ENSBTAG00000016988 transcript:ENSBTAT00000022592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSGSGKNGQGEPTRVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences Q5BIN5 W5PVE5
ENSOARP00000014428 NP_001029804.1.59421 NP_001029804.1.76553 XP_004008556.2.66739 XP_006044488.1.26621 XP_010826695.1.44457 XP_020763961.1.74333 ENSBTAP00000022592 9913.ENSBTAP00000022592 ENSBTAP00000022592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]