SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022647 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022647
Domain Number 1 Region: 1881-2015
Classification Level Classification E-value
Superfamily CalX-like 1.96e-22
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1767-1880
Classification Level Classification E-value
Superfamily CalX-like 2.09e-22
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 3 Region: 2127-2248
Classification Level Classification E-value
Superfamily CalX-like 2.62e-20
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 4 Region: 2007-2123
Classification Level Classification E-value
Superfamily CalX-like 8.24e-20
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 5 Region: 2250-2362
Classification Level Classification E-value
Superfamily CalX-like 1.7e-19
Family CalX-beta domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022647   Gene: ENSBTAG00000017032   Transcript: ENSBTAT00000022647
Sequence length 3172
Comment pep:known_by_projection chromosome:UMD3.1:12:23321909:23472303:-1 gene:ENSBTAG00000017032 transcript:ENSBTAT00000022647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQATGTPGVTARTRPAGNPTKSPPTPPTPSGLVLLLLLSLVSRVRAQPPDPGRALLSPDL
AGVAGVPAEEAIVLANRGLRVPFGREVWLDPLQDLVLQVQPGDRCAVTVLDNDALAQRPG
RLSPKRFPCDFGAGEVRYSHLGARSPSRDRVRLQLRYDAPGGAAVLPLVLEVEVVFTQLE
VVTRNLPLVVEELLGTSNALDARSLEFAYQPETQECRVGILPGLGALPRYGELLHYPQVP
GSASEGDSQEPLLMDCTAFQELGVRYRHTAPSRSPNRDWVPMVVELRSRGSPVGSPALKR
EHFQVLVRIRGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAECAPDLLIFNLT
SPFQPGQGFLVSTDDRSLPLSSFTQRDLHLLKIAYQPPSEDSDQERLFELELEVVDPEGA
ASDPFSFMVVVKPMNTLAPVVTRNTGLILYEGQSRPLTGPAGSGPQNLVISDEDDLEAVQ
LEVVAGLRHGHLVLLGASNGNSAPKTFTVAELAAGRVVYHHDDKDGSLSDNLVLLMVDGG
RRHQVQFLFPITLVPVDDQPPVLNANTGLTLAEGETVPILPQALSAIDMDSEDSLLLFVL
ESPSSTAGHLLLRQTHPPQGEEMLLGSPWRKQGIFYEKTVTQWRQRDITEGRLFYRHSGP
HSPGPVIDQFTFRVQDNHDPPNKSGLQRFMIRIHPVDRLPPELGSGCPLRMVVQESQLTP
LRKKWLRYTDLDTDDRELRYTVTQPPMDTDENHSPAPLGTLVLTDDPSVVVAHFTQAQVN
HHKIAYRPPDQELGVAARVAQFQFQVEDRAGNVAPGTFTFYLQPVDNQPPEILNTGFTVQ
EKGHHILSETELGVNDVDTDVAHITFTLIQVPKHGHMKLSGQVLHVGGIFHLEDIKQGRI
SYAHNGAESLTDSCSLEVSDRHHVVPITLRVNVRPMDGELPMLSLPAGTLGSYLDVLENR
ATEITANVIRGTNGDADDLMLTFLLEDPPLYGEILVNGVPAEQFTQRDILEGSVVYTHTS
GEIGLLPKEDSFNLSLSDMSQEWRIGGNTIQGVTMWVTILPVDSQAPEISVGEQFIVLEG
DKSAITSMHISAEDMDSLNDDILCTIVIQPTSGYVENISPAPGSEKSRAGIAVSAFTLKD
LRQGHINYVQSVHKGVEPVEDRFIFRCSDGINFSERHFFPIVIIPTNDEQPEIFIREFLV
MEGMSLVVDTPILNAADADVPPDDLTFTITKFPTHGHIMNQLINGTVLVESFTLDQIIES
SSIIYEHDDSETQEDSFVIQLTDGKHSVEKTVLIMVIPVDDETPRMAINNGLEIEIGETK
IINNRILMATDLDSEDKFLVYIIRYGPGHGLLQRQTPTGVFENITLGMNFTQDEVDSNLI
QYVHFGQEGIRDLIKFDVTDGINALIDRYFYVSIGSPDIVFPDVISKGVSLKEGGKVTLT
TDLLSTSDLNSPDENLVFTITRAPMRGHLESTDQPRVSITSFTQLQLAGNKIYYIHTADD
EVKMDSFEFQVTDGRNPVFRTFRISISDVDNKKPVVTIHNLVVSEGEKKLITPFELTVED
RDTPDKLLKFTVTQVPVHGQLLFNNTRPAMIFTKQDLNENLISYRHDGTESSEDSFSFTV
TDGSHTDFYVFPDTVFETRRPQVMKIRILAVDNRVPQIVVNKGASTLRTLATGHLGFMIT
SKVLKAEDRDSLHVSLRFIVTEAPRHGYLLNLGQGNHSVTEFTQADIDDMKICYVLREGA
NAVSDIFQFTVEDGGGNKLTKQHFRLNWAWISFEKEYYLINEDSKFLDVMLKRRGYLGET
SFISIGTRDGTAKKDKDFKGKAQRQVQFNPGQTRATWRVRILSDGAHEQSETFQVVLAEP
VLAALEFPAVTTVEIVDPGDESTVFIPQSEYSIEEDVGELFIPIRRSGDVSQELMVVCYT
RQGTARGTVPTSVLSYSDYISRPEDHTSVIRFDKDEREKMCRVVIIDDSLFEEEETFHVL
LSMPMGGRIGSEFPGAQVTIKPDKDDEPVFYFGDVEYKVDESAGSVEVRVWRSGTDLSQA
SSVTVTSQKTDPPSADAGTDYVGISRNLDFAPGVNMQTIRVIILDDLGQPMLEGIEQFEL
VLRMPMNAALGDPSKATVTINDSVSDLPKMHFKERVYTGNENDGQIVATIHRSGDTRYRS
SVRCYTRQGSAQVMMDFEERPNTDISIITFLPGEIEKPCILELMDDVLYEEVEELRLVLG
TPQSNSPFGAAVGEQNETLIRIRDDADKTIIKFGETKFSVSEPKEPGQSVVIKIPVIRQG
DTSKVSIVRVHTKDGSATSGEDYHPVSEEIEFKEGETQHIVEIEVIFDGVREMREAFTVH
LKPDENMIAETQATKAIVYIEEMNSMADVTFPSVPQVVSLLTYDDSSRAKESAGPVSGYP
VVCITACNPKYPDYEKTGSICASENINDTSTRYRWLISAPAGPDGVTSPMREVDFDTFFT
SSKMITLDSIYFQPGSRVQCAARAVNADGSEGLELMSPIVTIGREEGLCQPRVPGIVGAE
PFSAKLRYTGPEDSEYTNLIKLTVTMPHTDGMLPVISTKELSNFELTLSPDGTRVGNHKC
SNLLDYTEVKTHHGFLTDATKNPEIIGETYPYQYSSSIRGSNTLRFYRNLNLEACLWEFV
SYYDMSELLTDCGGTIGTDGQVLNLVQSYVTLRVPLYVSYVFHSPAGVGGWQHFDLKSEL
RLTFVYDTAILWTDGIGSPPEAELQGSLYPTSMRIGEEGRLVVNFKTEAQFHGLFVLSHP
ASFTSSMIMSVDHPGLTFSLRLIRSEPTYNQPVQQWSFVSDFAVRDYSGTYTVKLLPCTT
PSHQEFRLPVTCNPREPITFDLDIRFQQVSDPVAAEFSLNTQMYLLSKKSLWLSDGSMGF
GQESDVAFAEGDIIYGRVMVDPVQNLGDSFYCSIEKVFLCTGADGYVPKYNPTNAEYGCL
ADSPSLLYRFKIVDKAQPETQATSFGNVLFNAKLAVDDPEAILLVNQPGSDGFKVDSTPL
FQVALGREWYVHTIYTVRSKDSANRGIGKRSVEYRYHSLVGQGKPQAATKSRKKREIRSS
PPLAWEIGAENNRGTNIQHVALDRSSRKQILHGRVSPDGVLPRELNSPSSEVSLLTVVGG
VVVGLLAVILTAVTVRMHQGRKGARRKDAPKDPGSREPMMPSVSHHSDSSEV
Download sequence
Identical sequences F1MFH3
XP_002691845.1.76553 XP_015321125.1.59421 ENSBTAP00000022647 ENSBTAP00000022647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]