SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022687 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022687
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 2.22e-83
Family Integrin A (or I) domain 0.00000039
Further Details:      
 
Domain Number 2 Region: 361-451
Classification Level Classification E-value
Superfamily Integrin domains 3.19e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 621-698
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.28e-17
Family Integrin beta tail domain 0.0037
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000126
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family Integrin beta EGF-like domains 0.0011
Further Details:      
 
Domain Number 6 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022687
Domain Number - Region: 456-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Domain Number - Region: 500-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022687   Gene: ENSBTAG00000017060   Transcript: ENSBTAT00000022687
Sequence length 769
Comment pep:known chromosome:UMD3.1:1:145104446:145133581:-1 gene:ENSBTAG00000017060 transcript:ENSBTAT00000022687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRQRPQLLLLAGLLALQSVLSQECTNYKVSTCRDCIESGPGCAWCQKLNFTGQGEPDSI
RCDTRAELLSKGCPADDIMEPKSLAETRDSQAGSRKQLSPQEVTLYLRPGQAVAFNVTFR
RAKGYPIDLYYLMDLSYSMVDDLVNVKKLGGDLLRALNGITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQPPFAFRHVLKLTDNSKQFETEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKSSNEFD
YPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSEDSRNVVELIKNAY
NKLSSRVFLDHSTLPDTLKVTYDSFCSNGKSQVDQPRGDCDGVQINVPITFQVKVTATEC
IQQQSFTIRALGFTDTVTVRVLPQCECQCRDASRDGSICGGRGSMECGVCRCDAGYIGKN
CECQTQGRSSQELEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIYGQFCECDNVN
CERYDGQVCGGEKRGLCFCGTCRCDEQYEGSACQCLKSTQGCLNLDGVECSGRGRCRCNV
CQCDPGYQPPLCSECPGCPVPCAGFAPCTECLKFDKGPFAKNCSAACGQTKLLSSPVPGR
KCKERDSEGCWMTYTLVQRDGRDRYDVHVDDMLECVKGPNIAAIVGGTVGGVVLVGILLL
VIWKALTHLSDLREYHRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences P32592
ENSBTAP00000022687 NP_786975.1.59421 NP_786975.1.76553 XP_015329203.1.76553 ENSBTAP00000022687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]