SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022744 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022744
Domain Number 1 Region: 3892-4085
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.05e-40
Family Laminin G-like module 0.00059
Further Details:      
 
Domain Number 2 Region: 4146-4347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-38
Family Laminin G-like module 0.00064
Further Details:      
 
Domain Number 3 Region: 3646-3830
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.64e-33
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 383-467
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 3554-3641
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 1935-2023
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 3193-3286
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-19
Family I set domains 0.0079
Further Details:      
 
Domain Number 8 Region: 3094-3184
Classification Level Classification E-value
Superfamily Immunoglobulin 5.27e-18
Family I set domains 0.0096
Further Details:      
 
Domain Number 9 Region: 1656-1751
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 10 Region: 2028-2115
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 11 Region: 3477-3564
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 2419-2506
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-17
Family I set domains 0.036
Further Details:      
 
Domain Number 13 Region: 3274-3367
Classification Level Classification E-value
Superfamily Immunoglobulin 6.86e-17
Family I set domains 0.0096
Further Details:      
 
Domain Number 14 Region: 2612-2697
Classification Level Classification E-value
Superfamily Immunoglobulin 8.39e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 15 Region: 1752-1839
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-16
Family I set domains 0.0000226
Further Details:      
 
Domain Number 16 Region: 3005-3100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 17 Region: 3381-3466
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family I set domains 0.0094
Further Details:      
 
Domain Number 18 Region: 2908-2992
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000128
Family I set domains 0.03
Further Details:      
 
Domain Number 19 Region: 1845-1932
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000017
Family I set domains 0.032
Further Details:      
 
Domain Number 20 Region: 2521-2602
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000196
Family I set domains 0.013
Further Details:      
 
Domain Number 21 Region: 2132-2213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000305
Family I set domains 0.064
Further Details:      
 
Domain Number 22 Region: 2713-2795
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000488
Family I set domains 0.061
Further Details:      
 
Domain Number 23 Region: 2228-2308
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000739
Family I set domains 0.092
Further Details:      
 
Domain Number 24 Region: 2809-2895
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000743
Family I set domains 0.021
Further Details:      
 
Domain Number 25 Region: 2326-2407
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000306
Family I set domains 0.089
Further Details:      
 
Domain Number 26 Region: 261-298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 27 Region: 303-340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 1543-1595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 29 Region: 743-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 30 Region: 346-390
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 31 Region: 1138-1190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 32 Region: 3824-3865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000031
Family EGF-type module 0.016
Further Details:      
 
Domain Number 33 Region: 803-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000649
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 34 Region: 173-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 35 Region: 1602-1650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000778
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 36 Region: 1198-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000273
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 37 Region: 4088-4131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000355
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022744
Domain Number - Region: 1255-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number - Region: 864-905
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000368
Family Laminin-type module 0.031
Further Details:      
 
Domain Number - Region: 1100-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00161
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 1508-1545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00898
Family Integrin beta EGF-like domains 0.061
Further Details:      
 
Domain Number - Region: 705-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022744   Gene: ENSBTAG00000017122   Transcript: ENSBTAT00000022744
Sequence length 4374
Comment pep:known_by_projection chromosome:UMD3.1:2:131517579:131587498:1 gene:ENSBTAG00000017122 transcript:ENSBTAT00000022744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHGLRAYDGLSLPEDAETVTAGRAGWSYSDLSDDEDFLADEASGDGVGSGDLGSGDFQM
VYFRALVNFTHSIDYSPQLEDAGSEEFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELD
GWVFVELDVGSEGNADGAQIQEVLHGVISSGSIASYVTSPQGFQFRRLGTVPQVPRACTE
AEFACHRYNECVALEYRCDRRPDCRDMSDELDCEEPMPTLSSQPPPLGATPPPPAQPESL
PSQQRPATPAPQAALPSPGRPVPCGPHEAACHSGHCIPKDYVCDGQEDCADGSDEADCGP
TPPCEPNEFPCGNGHCALKLWRCDGDFDCEDHTDEADCPVKRPEDVCGPTKFRCVSTNTC
IPASFHCDEESDCPDRSDEFGCMPPQVVTPPQELIQASRGQTVTFTCVAIGVPTPIINWR
LNWGHIPSHPRVTVTSEGGRGTLTIHDVKEADQGAYTCEAMNARGMVFGIPDGVLELIPQ
RGPCPDGHFYLEHSASCLPCFCFGVTNVCQSSRRFRDQIRLRFDQPNDFKGVNVTMPAQP
GMPPVSSTQLQIDTTLQEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGSLRYKVRYE
LARGTLEPVQRPDVVLVGAGHRLLSRGHTSTQPGVPNQRQVQLSEEHWVHESGRPVQRAE
MLQVLQSLEAVLIQTVYDHKMASVGLSDVAMDTTVTYATSHGRAHSVEECRCPIGYSGLS
CESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFG
DATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAAGYEGN
PIQPNGKCRPINQQIVRCDERGSTGSSGEACLCKNNVVGRLCNECVAGSFHLSARNPDGC
LKCFCMGVSRQCTSSSWRRAQVLGASEEPTRFTLTNPTGTHNASEGISSPSPGELVFSSF
HSLPPGPYFWSLPPHFLGDKVTSYGGELRFTVTQRPQPGSAPLPGQPLVVLQGNNIVLEH
HTSQQPSSGQPSTFTVPFWEQAWQRPDGQPATREHLLMALADIDSLLIQASHTQRPAESR
VSGISMDVAVPEDTGQDPAREVEQCACPPGYRGPSCQDCDAGYTRMPSGLYLGTCERCSC
HGHTEVCEPETGACQECQHHTEGPRCEQCQPGYYGDAQRGTPHDCQPCPCHGAPAAGQAT
HTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCRRSGGQLPEQIGCGCDPQ
GSVSNQCDPAGQCQCKAQVEGLTCSQCRPHHFHLSASNPDGCLPCFCMGVTQQCASSSYT
RQLISTRFAPGDFQGFALVNPQRNSRLTGGFSVEPVPEGTQLSFGNFAHLGHESFYWQLP
ETYQGDKVAAYGGKLRYTLSYTAGAQGSPLSDPDVQITGNNIMLVASQPALQGPERKNYE
VVFQEEFWRRPDGQPATREHLLMALADLDELLVRATFSSMPLAASISGVSLEVAQPGPSE
GPRALEVEECRCPPGYVGSSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACS
QCQHHAAGEFCEQCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTA
CEPGYTGQYCEQCAPGYVGNPNVPGGRCLPQADQAPLVVQVHPTRSVVPQGGPHSLRCQV
SGSPPHYFYWSREDGRPLPSSTQQRHQGSELHFPSVQPSDAGVYICTCRNLHHANTSRAE
LLVTEAPGKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMD
FNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQASATPSAPVVSIHPPQLTVQPG
QMAEFRCSATGHPMPSLEWTGGPGGQLPQKAQVHRGILRLPAVEASDQGQYLCRAHSSAG
QHVARAVLHVHGGNGPRVQVSPERTQVHEGRTVRLYCRAAGVPSATITWRKEGGSLPPQA
RAERTDIATLLIPAITAADAGFYLCVATSPAGTAQARIQVVVLPGATTPPVRIESSSPSV
TEGQTLDLNCVVAGLAHSQITWYKRGGSLPPHAQVRGSRLRLPQVSPADSGEYVCRVEND
SGPKEASIIVSVLHSRHPGPGYTPAPGGTQPVRIEPSSSHVAEGQTLDLNCVVPGQAHAQ
VTWYKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCRVVLGSGPLETSVLVSIEASDAGT
IPAPGPVPPVRIESSSPTVAEGQTLDLNCVVAGQAHAPVTWYKRGGTLPARHQVRGSRLY
IFQASPADAGEYVCRASNGVEASITVTVTKTQGANFAYPPGGTQPVRIEPSSSHVAEGQT
LDLNCVVPGQPHAQVTWHKRGGSLPARHQTHGSLLRLYQVSPADSGEYVCRVVGGSVPLE
SSVLVSIEPVDSVPALGVTPPVRIESSSSHVAEGQTLDLNCLVSGQPHAQVTWHKRGGSL
PARHQVHGSRLRLPQMTPADSGEYVCRVVSGSGTQEASVLVTIQQRRGPTRYQNVVYPVR
IESSSDSLANGRTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGE
YVCHVSNGAGSQETSLIVTIQGSDSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVAGQP
QATITWYKRGGSLPARHQAHGSRLRLHQMSVADSGEYVCRANNNIDALEASIVVSVTPGT
GGPSGPSGTMPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTWHRRGGSLPAHHQTHGSR
LRLHRVSPADSGEYVCRVALGSGPLEASVLVTIEASGSGSVVVPAPGGAPPIRIETSSSH
VAEGQTLDLKCVVPGQAHAQVTWHRRGGSLPARHQVHGPLLRLNHVSPADSGEYSCQVSS
SSGTLEASVLVTIEASSPSPIPAPGLAQPIHIEASSSHVTEGQTVDLNCVVPGQAHAQVT
WHKRGGSLPTRHQTHGSRLRLHHVSQSDSGEYVCRVVGGSGSEQEASFTITVPPSAGSSY
RLRSPVISIDPPSSTVQQGQDASFKCLVHDGAAPISLEWKTRNQELEDNVRISPNGSIIT
IVGARPSNHGAYRCVASNAYGVAQSVVNLSVHGPPVVSVLPEGPVRVKLGKDVTLECVSS
GEPRSSARWTRIGAPTHLEQRAHGLLDSHTVLQISSAKPSDAGTYVCLAQNALGTAQKRV
EVIVDTGAVAPGAPQVQVEEVELTVEAGHTATLRCSATGSPKPTIHWSKLRSPLPWQHRL
EGDTLIIPRVAQQDSGQYICNASSPAGHAEATVVLHVESPPYATTVPEHASVRAGEAVQL
QCLAHGTPPLTFQWSRVGGHLPAGATARNELLLFEAAAPEDSGRYRCQVTNRVGLAEAFA
QVLVRGPSGSLPATPAPAGSAPTVQVTPQLETKSIGASVEFHCVVPSDPGTQLRWVKEGG
PLPPGHSVHDGVLRIQNLDQNCQGTYVCQAQGPWGQAQASAQLVVQALPSVLINIRTSVQ
SVVVGHAVEFECLALGDPKPQVTWSKVGGRLRPGIVQSGGIVRIARVELADAGQYRCTAT
NAAGTTQSHVLLLVQALPQISTPPEVRVPAGSTAVFPCMVSGYPAPEITWSKLDGNLPPD
SRLENHMLLLPSVQPQDAGTYVCTATNRQGKVKAFAQLQVPAERVVPYFTQTPYSFLPLP
TIKDAYRKFEIKITFRPDSADGMLLYNGQKQIPGSPANLANRQPDFISFGLVGGRPEFRF
DAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGSLAPVNGTSQGKFQGLDLNEELY
LGGYPDYGAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGG
QCQDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGHGYTCRCHLGRS
GMRCEEGVTVTTPSLSGTDSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVE
DFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHHVSAERLNKDGSLQVNGGRPVLR
SSPGKSQGLNLHTLLYLGGVEPAVQLPPATNVSAHFHGCVGEVSVNGKRLDLTYSFLGSQ
GVGQCYDSSPCERQPCRHGATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLHEPCLHGG
TCQGTHCLCPPGFSGPRCQHSSAHGLVESDWHLEGSGGNDAPGQYGAYFYDNGFLALPGR
IFSRSLPEVPETIELEVRTSTASGLLVWQGEETGQSGRGKDFISLGLQDGHLVFSYQLGS
GEARLVSEDPINDGEWHRVTALREGQRGSIQVDGEELVSGQSPGPNVAVNTKGSIYVGGA
PNVAVLTGGRFSSGITGCIKNLVLHSARPGGPPPQPVDMQHRAQAGANTRPCPS
Download sequence
Identical sequences F1MER7
ENSBTAP00000022744 ENSBTAP00000022744 9913.ENSBTAP00000022744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]