SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022788 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022788
Domain Number 1 Region: 405-442,562-699
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.68e-45
Family Phosphate binding protein-like 0.0000032
Further Details:      
 
Domain Number 2 Region: 2-176
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000000101
Family L-arabinose binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022788   Gene: ENSBTAG00000017146   Transcript: ENSBTAT00000022788
Sequence length 751
Comment pep:known_by_projection chromosome:UMD3.1:15:32032518:32103782:1 gene:ENSBTAG00000017146 transcript:ENSBTAT00000022788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFIKFQFQRFTTLNLHPS
NTDISVAVAGVLNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDARDPTP
LLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYYTYIFTNLTVSLIRVTDPADGC
ISSIGPSSWSSSFAPYQLFTESHKDNTEGCHHTSFPCPSLSPRNKFESINSSVFCLLGSS
SHIWIEPMSPALAANSGKSLVDIRDMGSVPGLGRFLPGESHGQRSSAGYSPQRERRAGLK
RQLQWHPTPQQQQQSSNQTSLPSQGLIYLTAVMNTLLEKYRMSSKRHSSEMEKKLTFVNG
CILQACDVGPLAQFLAFISSLGDKCVPVPPSHGATPLMTSLCSFQKADLAVAGLTITAER
EKVIDFSKPFMTLGISILYRVHMGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVAR
LTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVWWA
FTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTY
QRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTK
GYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWEGGKCPKEEDHRAKGLGMENIGG
IFVVLICGLIVAIFMAMLEFLWTLRHSEATE
Download sequence
Identical sequences F1MCW8
ENSBTAP00000022788 ENSBTAP00000022788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]