SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022795 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022795
Domain Number 1 Region: 403-534
Classification Level Classification E-value
Superfamily CalX-like 8.37e-37
Family CalX-beta domain 0.000000188
Further Details:      
 
Domain Number 2 Region: 534-627,661-724
Classification Level Classification E-value
Superfamily CalX-like 6.8e-31
Family CalX-beta domain 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022795   Gene: ENSBTAG00000013861   Transcript: ENSBTAT00000022795
Sequence length 970
Comment pep:known chromosome:UMD3.1:11:22443220:22797877:-1 gene:ENSBTAG00000013861 transcript:ENSBTAT00000022795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQFSLSPTLSMGFHVIAMVALLFSHVDHISAETEMEGEGNETGECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHVDSF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVAENDPVSKIFFEQGTYQCLENCG
TVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVKVSLEASEDGILEASHVSTLACLGSPSTATVTIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLYGQPVFRK
VHAREHPLPSTIITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTRLEVIIEESYEFK
STVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTV
FWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVAL
GTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVS
PGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSS
LEAYCHIKGF
Download sequence
Identical sequences F1MC36
9913.ENSBTAP00000022795 ENSBTAP00000022795 XP_005212620.1.76553 XP_010808215.1.76553 XP_010808216.1.76553 XP_015328911.1.76553 XP_015328912.1.76553 XP_015328913.1.76553 ENSBTAP00000022795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]