SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022815 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022815
Domain Number 1 Region: 613-838
Classification Level Classification E-value
Superfamily vWA-like 1.5e-62
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 44-240
Classification Level Classification E-value
Superfamily vWA-like 3.62e-57
Family Integrin A (or I) domain 0.00024
Further Details:      
 
Domain Number 3 Region: 284-404
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-18
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 4 Region: 406-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000001
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 5 Region: 244-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000644
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 528-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.049
Further Details:      
 
Domain Number 7 Region: 572-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family EGF-type module 0.019
Further Details:      
 
Domain Number 8 Region: 914-956
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000523
Family Chicken cartilage matrix protein 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022815   Gene: ENSBTAG00000017165   Transcript: ENSBTAT00000022815
Sequence length 959
Comment pep:known chromosome:UMD3.1:14:68478180:68651684:-1 gene:ENSBTAG00000017165 transcript:ENSBTAT00000022815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMLVGCFLLLFGPTLLLLPAEARERRPPPRSTSRGRHARTHPQTALLGSACENKRADV
VFIIDSSRSVNTHDYAKVKEFIVDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKS
EVERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVA
EVAAKARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQIETLTSVFQKKLCT
VHMCSILEHNCAHFCINTPGSYVCRCKQGYILNSDEKTCRIQDLCAADDHGCEQLCVNLL
GSFVCQCYSGYALAVDGKRCEPVDYCASENHGCEHECVNADGSYLCRCPKGFALNPDKKT
CAKIDYCASPNHGCQHECVNTDDSYACRCLKGFTLNPDQKTCRRINYCALNKPGCEHECI
NTEEGYYCRCRRGYTLDPNGKTCSRVDHCAEQDHGCEQLCLNTEDSFVCQCSEGFLINDD
LKTCSRVDYCLLSRHGCEYSCVNTDRSFVCECPEGHVLRSDGKTCAKLDACALGKHGCEH
LCISSGDSFVCRCFEGYILRGDGKTCRRKDVCQAVDHGCEHACVSTGESYVCKCMEGFRL
AEDGKRCRRKDVCKSTHHGCEHICVNRGNSYICKCSKGFILAEDGRRCKRCTEGPVDLVF
VIDGSKSLGEDNFEIVKQFVTGIIDSLAISPKAARVGLLQYSTLVRTEFTLRNFSSAKDM
KKAVAHMKYMGKGSMTGLALKHMFERSFTQVEGARPLSARVPRVAIVFTDGRAQDDVSEW
ASKAQASGITMYAVGVGKAIEEELQEIASEPTEKHLFYAEDFSTMGEISDKLQKGICEAL
EDSDGRQDSPAGELPKRVHQPTESEPVTINIRDLLSCSNFAVQHRYLFEEDNLARSTQKV
FHSTKSSGSPLEEKQDQCKCENLIMFQNLANEEVRKLTQRLLEEMTQRMEALENRLRYR
Download sequence
Identical sequences F1MHR8
9913.ENSBTAP00000022815 ENSBTAP00000022815 ENSBTAP00000022815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]