SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022890 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022890
Domain Number 1 Region: 246-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-41
Family SPRY domain 0.00092
Further Details:      
 
Domain Number 2 Region: 16-85
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022890   Gene: ENSBTAG00000017225   Transcript: ENSBTAT00000022890
Sequence length 424
Comment pep:known chromosome:UMD3.1:19:18330388:18343193:-1 gene:ENSBTAG00000017225 transcript:ENSBTAT00000022890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLDAGRAIPVWLAEDDLGCIICHDLLAWPATLPCGHTFCRDCLLDLWAARRSRFCPSC
REGAPGPPQLRKNTMLEDLADKYRLAARELEPLSPGPEPTPAPRPASRPGRPTAQLRVEA
PKSSTEVDRELAKLVERLIDIVRKLQSPRHLLESEPDKEVSVLAMTLLDGVDLSLASPKV
SSSPPEQKMKDILHDLEEIQEKLRENFTQKGALEEQTQVELPEVPSSSSCPLPDQSRFAP
KKASSFARWAISPTFDLESLSCNLKVSVDLRTVTVSDFPMLYAWSPERFASSQALCSQAL
SSGQHYWEVDTQRCSHWAVGVASRGMKRDQILGRTTDSWCVEWKGASQLSAWCMVKETVL
GSDRPSVVGIWLDLEEGKLAFYSKADQAKPLFECPISVSVPLHPAFWLYGLDPGNSLTIR
KMNV
Download sequence
Identical sequences F1MGD1
9913.ENSBTAP00000022890 ENSBTAP00000022890 ENSBTAP00000022890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]