SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023088 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023088
Domain Number 1 Region: 189-430,458-540
Classification Level Classification E-value
Superfamily DNase I-like 1.24e-36
Family DNase I-like 0.048
Further Details:      
 
Domain Number 2 Region: 41-136
Classification Level Classification E-value
Superfamily L domain-like 1.19e-25
Family Internalin LRR domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023088   Gene: ENSBTAG00000017362   Transcript: ENSBTAT00000023088
Sequence length 557
Comment pep:known chromosome:UMD3.1:7:493450:574753:-1 gene:ENSBTAG00000017362 transcript:ENSBTAT00000023088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWVELEISGKVRSLSSSLWSLTHLTALYLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYLEPDGTRRLLNYLLDNLAGTAKRIATEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEISSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLQSSVLGEFGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGTTNGRITHGFKLKSAYESGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR
Download sequence
Identical sequences A6QR51 L8I9S2
9913.ENSBTAP00000023088 ENSBTAP00000023088 NP_001094631.1.59421 NP_001094631.1.76553 XP_005900563.1.15283 XP_010839235.1.44457 XP_019819255.1.53367 ENSBTAP00000023088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]