SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023092 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023092
Domain Number 1 Region: 466-624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-43
Family MAM domain 0.00064
Further Details:      
 
Domain Number 2 Region: 127-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-29
Family MAM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 298-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-28
Family MAM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 8-127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-18
Family MAM domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023092   Gene: ENSBTAG00000017369   Transcript: ENSBTAT00000023092
Sequence length 646
Comment pep:known_by_projection chromosome:UMD3.1:8:46594200:46690016:1 gene:ENSBTAG00000017369 transcript:ENSBTAT00000023092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPGSPSLLGHYIYVDTSFAKQGEKAVLLSPDLQAEEWSCLRLVYQIATSSGSPSDPSRL
NLYMRFEDESFDRLFWSAKEPSDSWLIASLDLQNSSQKFKILIEGVLGHGNTSSIALFEI
KMTTGYCIECDFEENHLCGFVNHWNPNVNWFVGGGNTRNSNSSLPQDHTLKSELGHYMYV
DSIYVKHFQEVAQLISPMTTAPMSGCLSFYYQLQQRNDNIFSVYTRDAAGLYEEIWKAGD
PGNAVWNLAEAEFSAPYPKEVIFEVAFNGPKGGYVALDDISFSPVHCQNQTERPFSALEA
SCNFEEDLCNFYQDKEGSGWTRVKVKPNLYRAGDHTSGLGYFLLADTKFTSQPGYIGRLY
GPSLPGNQQYCLRFYYAISGFLKMSDTLAVYIFEENHVVQDKIWSVLESPRGIWMQAEIT
FRKPMPTKVVFMSLCKSLWDCGLVALDDITIELGSCWSPEKLLLPPGECTFEQDECIFTQ
ERRNRSSWQRRRGETPTSYTGPKGDHTTGVGYYMYIEASHLVYGQKARLLSRPLRGVTGK
HCLTFFYHMYGAGTGLLNVYLKKEGDSEESLLWRRRGEQSISWLRALIEYSCERQHQIII
EAIRGMSVRSDIAIDDIKFQAGSCAEMEDKSQQSSGYSEDLNEIEY
Download sequence
Identical sequences F1MZ93
ENSBTAP00000023092 ENSBTAP00000023092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]