SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023206 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023206
Domain Number 1 Region: 223-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 154-264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000132
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000023206
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000133
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 338-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000596
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023206   Gene: ENSBTAG00000017448   Transcript: ENSBTAT00000023206
Sequence length 498
Comment pep:known chromosome:UMD3.1:11:38338744:38408288:-1 gene:ENSBTAG00000017448 transcript:ENSBTAT00000023206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEGAGAAANAAATSSTGTGGVAATGVAASG
VVPGGGFVASAAAEVQTGRNNFVTRRNPSDPQRIPINPSHRIQCATGYEQSEHNVCQDID
ECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGEQCVDVDECTIPPYCHQRCVNTPGSF
YCQCNPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDI
DECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRGRTCQDINECETTNECREDEMCWNYHG
GFRCYPRNPCQDPYVLTSENRCVCPVSNAMCREIPQSIVYKYMSIRSDRSVPSDIFQIQA
TTIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEMVTVNSIGT
FRTSSVLRLTIIVGPFSF
Download sequence
Identical sequences A2VE41
ENSBTAP00000023206 ENSBTAP00000023206 NP_001075186.1.59421 NP_001075186.1.76553 XP_005212658.1.76553 XP_010808233.1.76553 XP_019825736.1.53367 XP_019825737.1.53367 XP_019825738.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]