SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023245 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023245
Domain Number 1 Region: 284-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 2 Region: 443-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 340-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 721-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 5 Region: 396-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023245   Gene: ENSBTAG00000017473   Transcript: ENSBTAT00000023245
Sequence length 1585
Comment pep:known_by_projection chromosome:UMD3.1:11:101247082:101315225:1 gene:ENSBTAG00000017473 transcript:ENSBTAT00000023245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAERRVVGGPPTMGTAAALLLSLALLAPRAAGARMGACYDGAGRPQRCLPVFENAAFGRL
AEASHTCGRPPEDFCPHVGAQGAGAPCQRCDAADPARHHNASYLTDFHSQDDSTWWQSPS
MAFGVQYPTSVNITLNLGKAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASC
QKTYGRPEGLFLRPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQE
WVTSTELLVSLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDEEGR
LACRCQHNTTGTDCERCLPFFQDRPWARGTAEAANECLPCNCSGHSEECTFDRELFRSSG
HGGRCLHCRAHTAGPHCERCQENFYRWSPQTPCQPCDCHPAGSLRLQCDDLGTCVCKPTV
MGWKCDRCLSGFHSLSEGGCRPCTCNPVGSLGTCDPRSGRCHCKENVEGSLCDRCRPGAF
NLQPHNPAGCSSCFCYGHSKVCVAAAQFQEHHILSDFRQGAEGWRAGSVGDPGHPARWSP
GGLLLDPEDEEAELTAPEKFLGDQRFSYGQPLTLTFQVPRGSSLSTQLRLEGAGLALTLR
HSGSPRTPVSGQAGEVRLKFLLQETSEDVDPPLSAFHFQRVLANLTALRIRTSGHSTSSS
GPVLLTEVRLTSARRGLSPPASWVETCSCPQGYTGQFCESCAPGYKRNTPLGGPYASCVP
CTCNQHGTCDPNTGVCLCGHHTEGPSCERCLPGFYGNPFTGQADDCQPCPCPGQSACTTI
PESGEVVCTHCPRSQRARAVGCCGFLAELGPLSTSRWEFGNRRIQPCPNPQSLVAVTPCS
PRGHVPGALRCSLNTLYSCCCCCREGQKLGVGVRGRPGSHCSRCSCDGSGGRQARHQDQD
LTAVSPGSDCEVCSKAFWTSESMRELGTCIPHPLGWLQGEPHLAPSECSINAFIVHMIER
TGLGDGAECCHSVCKDRMFAPCQVLGTCTMGVRREGSAPRMGKGTVGPQRSSVSFTLRPR
LGLEKATLVGMAGQEAAKLKARLTLMEGWLQGSDCGRPWGPLDILQGEAPRGDIYQGPHL
LQGAQEAFLEQVTGLEGAVKAAREQLQALGRSARCAQAGVEKTCIQLADLEAALESSEEE
ILHAATILASLVIPQEGLGQPTNWSKLATEAHALARSHRDTAAKIEATARRALLASNTSY
ALLWSLVEGRAALEAQQELEDRYQEVQAAQKALGTAVAEALPEAERVLAAVQQAGVAAAL
HLASPSAPASPPQKSQAEAVSLKVQTLEKTVTSREHMVTEAAGSLQATAQAVLQEMEPLT
QLHQEARAALTRASSSVQAATVTVMGARTLLADVEGMKPRFPRPKDQAALRRKAAIVQDR
ILADSRKKTKQAERMLGDAASVSSRAKKKGREAELLAQDSAKLAKALLRAGKQEHRRASG
LSSQTRATLGLASRQLLASEAHRQELEAAEWDGAGLSQMERQIRESRTSLEKDIKALLDL
LARLGSLDTHRAPARALNETQWALERLRLRLSPPGALQGKLSLLEQESKLQELQIQSFEN
DLSELRADKQNLEAILHSLPESCAS
Download sequence
Identical sequences F1N0T1
ENSBTAP00000023245 ENSBTAP00000023245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]