SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023366 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023366
Domain Number 1 Region: 318-495,530-696
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.15e-78
Family YicI catalytic domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 1191-1383,1428-1589
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-73
Family YicI catalytic domain-like 0.00037
Further Details:      
 
Domain Number 3 Region: 74-317
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.47e-50
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 941-1187
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.89e-46
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 5 Region: 1592-1672
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000115
Family Putative glucosidase YicI, domain 3 0.021
Further Details:      
 
Domain Number 6 Region: 699-779
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000187
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 
Domain Number 7 Region: 913-965
Classification Level Classification E-value
Superfamily Trefoil 0.0000000575
Family Trefoil 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023366   Gene: ENSBTAG00000006975   Transcript: ENSBTAT00000023366
Sequence length 1812
Comment pep:known_by_projection chromosome:UMD3.1:1:103088853:103204728:1 gene:ENSBTAG00000006975 transcript:ENSBTAT00000023366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQKFSGLEITLIVLFAIVTIIAIALIVVLATKTPAVEEISDSTRGTCPSVLNDPINHR
INCIPERSPTQTLCAARGCCWRPWNDSVIPWCFFVNNHGYNAEKVTSTNAGVEAKLKRKA
SPTLFGNDINSVLLTTQSQTRNRVRFKITDPNNRRYEVPHQFVKEFSGTAASDPLYNVEV
IHDPFSIKISRRSNSKILFDTSIGPLVYSDQYLQISARLPNEYIYGLGEHIHKRFRHDLY
WKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSNAMEIFIQPTPIVTY
RVIGGILDFYIFLGDTPEQVVQQYQELIGRPAMPAYWNLGFQLSRWNYKTLDVVKAVVQR
NRDAGIPFDTQITDIDYMEDKKIFTYDQVTFNGLPEFVQDLHAHGQKYVIILDPAVSIEK
RANGAAYESYDRGTAQKVWVNESDGTTAIIGEVWPGLTVYPDFTNPSCIEWWANECYLFH
QQVNYDGLWIDMNEVSSFVQGSKKGCSANNLNYPPFTPDILDKLMYSKTICMDAMQYWGK
QYDVHSLYGYSMSIATEKAIEKVLPNKRSFILTRSTFAGSGSHSAHWLGDNTASWEQMEW
SITGMLEFGLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPYARNHNADGYEHQDPAF
FGKDSLLVKSSKHYLNIRYALLPFLYTLFYKAHMFGETVARPFLHEFYEDTNSWIEDTQF
LWGPSLLITPVLRQGAETVSAYIPDATWYDFETGVKKPWRKQRVDMQLPADKIGLHLRGG
YIIPFQQPAVTTTASRKNPLGLIIALNDNNTAKGDFFWDDGETKDTIQKGNYILYTFSVS
NNKLDITCMHSSYPEGTALAFETIKVLGLINTVTEVSVIEDNQPLRAHYNFSYDASNQIL
LIHNLTFNLGGNFTVQWDQTFLEVEKFTCYPDSNTATKELCEERGCLWQTVHLGSKAPEC
YFPKEDNSYLVHSTQYSSVGITADLQLNTANRIKLPSDSISSLRVEVKYHKDDMLQFKIY
DAQNKRYEVPVPLNIPNTPTSTYETRLYDVEIKENPFGIQIRRRSTRRVIWDSRLPGFAF
NNQFIQISTRLPSEYVYGFGEMEHTTFKRDLNWHTWGMFTRDQPPGYKLNSYGFHPYYMA
LEDENNAHGVLLLNSNAMDVTFQPMPALTYRMIGGILDFYMFLGPSPEVTTKQYHEVIGQ
PVMPPYWALGFQLCRYGYRNTSQVEEVYNDMVAAQIPYDVQYTDIDYMERQLDFTIDDEF
HDLPQFVDKIRSEGMRYIIILDPAISGNETKPYPAFERGQEKDVFVKWPNTSDICWAKVR
PDLPNVTIDQSLTEDEAANATKAHAAFPDFFRNSTAEWWAREIIDFYNNQMKFDGLWIDM
NEPSSFVNGTTTNQCRNAELNYPPYFPELTKRTDGLHFRTVCMETEQILSDGSSVLHYDV
HNLYGWSQLKPTYDALQKATGKRGIIISRSTYPSAGRWSGHWLGDNYATWDNLEKSIIGM
MEFSLFGMSYTGADICGFFNNSEYQLCARWMQLGAFYPYARNHNSAFTRRQDPASWNKTF
SAMSRDILNIRYTLLPYFYTQMYEIHAHGGTVIRPLLHEFLNEKPTWDIFKQFLWGPAFM
VTPVLEPYVDTVEGYVPNARWFDYHTGKDIGVRETFHTFAAPLYEINLHVRGGYILPCQE
PANNTFYSRQNYMKLIVAADDNQMAQGSLFWDDGETIDTYERDLYSLVQFNLNKTILTST
ILKNGYINRNEMRLGYIHIWGKEKMRVSEVTLTHNGNKESVNFTEDPNLEILDIDLTGNN
VTLDEPIEVNWS
Download sequence
Identical sequences E1BGH5
ENSBTAP00000023366 NP_001107661.1.59421 NP_001107661.1.76553 XP_005201772.1.76553 ENSBTAP00000023366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]