SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023490 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023490
Domain Number 1 Region: 495-722
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-58
Family Eukaryotic proteases 0.00000000528
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-36
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 210-293
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 4 Region: 302-385
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 380-477
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-29
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 7.85e-22
Family Hairpin loop containing domain 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023490   Gene: ENSBTAG00000017664   Transcript: ENSBTAT00000023490
Sequence length 730
Comment pep:known chromosome:UMD3.1:4:39116167:39197870:1 gene:ENSBTAG00000017664 transcript:ENSBTAT00000023490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTRLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKRSAKTTLIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTETGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDLPM
QTTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGSLSKTRSGLTCSMWDKNME
DLHRHIFWEPDATKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAILDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKAPQS
Download sequence
Identical sequences F1MZD6
ENSBTAP00000023490 XP_005205371.1.76553 ENSBTAP00000023490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]