SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023518 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023518
Domain Number 1 Region: 72-117
Classification Level Classification E-value
Superfamily LysM domain 0.000000000902
Family LysM domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023518   Gene: ENSBTAG00000017683   Transcript: ENSBTAT00000023518
Sequence length 215
Comment pep:known chromosome:UMD3.1:10:58731531:58744506:1 gene:ENSBTAG00000017683 transcript:ENSBTAT00000023518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPAPSLRAGGPREPRPSAPSPPPPHSRLGSEAEEAELSLSLARTKTRSYGSTASVR
APLGAGVIERHVEHRVRAGDTLQGIALKYGVSMEQIKRANKLFTNDCIFLKKTLNIPVIS
EKPLLFNGLNSVDSPENETVDSFSHEEELVAAGEDVSPLSPQELDVQPMQPEEVSARDFL
QRLDLQIKLSTQAAKKLKGESRDEEGLYTASLYHS
Download sequence
Identical sequences Q1JQA8
9913.ENSBTAP00000023518 ENSBTAP00000023518 NP_001068953.1.59421 NP_001068953.1.76553 XP_019824389.1.53367 ENSBTAP00000023518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]