SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023559 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023559
Domain Number 1 Region: 249-564
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 4.32e-39
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 666-835
Classification Level Classification E-value
Superfamily C-type lectin-like 6.7e-27
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 48-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 972-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023559   Gene: ENSBTAG00000017709   Transcript: ENSBTAT00000023559
Sequence length 1180
Comment pep:known_by_projection chromosome:UMD3.1:26:35862687:36163723:1 gene:ENSBTAG00000017709 transcript:ENSBTAT00000023559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCYGLIYLALYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEP
SGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAV
LSGLIVPEIRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCT
TSVSVSNQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSL
NVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSI
WNVGAVSRGPLQRYGHSLALYQENIFMYGGRIETSDGNVTDELWVFNIHSQSWSTKTPTV
LGHGQQYAVEGHSAHIMELDSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGA
IVQGGYGHTSVYDEITKSIYVHGGYKALPGNKYGLVDDLYKYEVNPKTWTILKESGFARY
LHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRF
GHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKNAGPGIKCIWNKNHCES
WDSGNTNNILRAKCPLKTAASDDRCYRYADCASCTANTNGCQWCDDKKCISSTSNCSMSV
KNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAHLCGEGWIHVGDACLRI
NSSRENYDNAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWG
WEDMSPFTNTTLQWLPGEPNDSGFCAYLERAAVAGLKANPCTSMADGLVCEKPVVSPNQN
ARPCKKPCSLRTSCSNCTSNGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQN
CSGLRTCGQCLEQPGCGWCNDPSNTGRGHCIEGSSRGPMKLVGMLNNEMLLDTSLCPKEK
NYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTC
SGHANICHMHTGKCFCTTKGIKGDQCQFCKATHFYSGTNRKYTCTYFNSLLIDYQFTFSL
LQEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKT
NIKEYRDSFSYEKFNFRSNPNITFYVYVSNFSWPIKIQVS
Download sequence
Identical sequences F1MXV1
ENSBTAP00000023559 ENSBTAP00000023559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]