SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023573 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023573
Domain Number 1 Region: 1810-1969
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000292
Further Details:      
 
Domain Number 2 Region: 1490-1664
Classification Level Classification E-value
Superfamily Cupredoxins 1.56e-48
Family Multidomain cupredoxins 0.0000254
Further Details:      
 
Domain Number 3 Region: 350-533
Classification Level Classification E-value
Superfamily Cupredoxins 4.18e-45
Family Multidomain cupredoxins 0.0000455
Further Details:      
 
Domain Number 4 Region: 31-204
Classification Level Classification E-value
Superfamily Cupredoxins 8.41e-43
Family Multidomain cupredoxins 0.0000000164
Further Details:      
 
Domain Number 5 Region: 540-669
Classification Level Classification E-value
Superfamily Cupredoxins 4.25e-34
Family Multidomain cupredoxins 0.00022
Further Details:      
 
Domain Number 6 Region: 1673-1813
Classification Level Classification E-value
Superfamily Cupredoxins 1.82e-32
Family Multidomain cupredoxins 0.000000153
Further Details:      
 
Domain Number 7 Region: 208-329
Classification Level Classification E-value
Superfamily Cupredoxins 1.19e-31
Family Multidomain cupredoxins 0.000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023573   Gene: ENSBTAG00000017722   Transcript: ENSBTAT00000023573
Sequence length 1970
Comment pep:novel chromosome:UMD3.1:16:37973199:38045988:-1 gene:ENSBTAG00000017722 transcript:ENSBTAT00000023573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLACPGFWVLVVLGSSWAGWGNLGAEAAKLRQFYVAAQSIRWNYRPESTHLSSKPFETS
FKKIVYREYEAYFQKEKPQSRTSGLLGPTLYAEVGDIMKVHFKNKAHKPLSIHAQGIKYS
KFSEGASYSDHTLPMEKMDDAVAPGQEYTYEWIISEDSGPTHDDPPCLTHIYYSYVNLVE
DFNSGLIGPLLICKKGTLTEDGTQKMFEKQHVLMFAVFDESKSWNQTSSLMYTVNGYVNG
TMPDITVCAHDHISWHLIGMSSGPELFTIHFNGQVLEQNHHKISAITLVSATSTTANMTV
SPEGRWTIASLIPRHFQAGMQAYIDIKNCAKKTRNPKKLTRDQRRHIKRWEYFIAAEEVI
WDYAPIIPANMDKKYRSLHLDNFSNRIGKHYKKVVYKQYQDDSFTKRLEDPSSEGDGILG
PIIRAQVRDTLKIVFKNMASRSYSIYPHGVTFSPYDNEVNSSSTSGSNTMIRAVRPGETY
TYKWNILESDEPTENDAQCLTRPYYSNVDITRDLASGLIGLLLICKSRSLDRRGIQRAAD
IEQQAVFAVFDENKSWYIEDNIYKFCENPEKVKRDDPKFYESNIMSNFTLPAINGYVPES
IPILGFCFDDTVQWHFCSVGTQNDIFTIHFTGHSFIYGKRHEDTLTLFPMQGESVTVTMD
NVGTWMLTTMNSNPRSKKLRLRFRDAKCIRNDDDDSYEIIYEPSGSTAMTTKKIHDSSEI
EDENDADSDYQDELALILGLRSFRNSSLNQEKDELNLTALALEKDSEFIPPSANRSLDSN
SSSPSHVSRLIAKNFAESLKTLLHLEAPAAGSPLEHAGLDKNSALNPPMAEHSSPYSEDP
REDHPLSDVTGISLLPFGTGFKNRKPAKHQRFQVGRGQAAKHKFSQTRFPAHKTRTRLSQ
DNSSSSRMGPWEDIPSDLLLLQQKDPYKILNGEWHLVSEKGSYEIIQDANENKTVNKLPN
SPQNDSRTWGENIPFKNSHGKQSGHPTFLVTRRKPLQDRQDRRNSRLKEGLPLIRTRRKK
KEEKPAYHVPLSPRSFHPLRGEVNASFSDRRHNHSLLLHASNETSLSIDLNQTFPSMNLS
LAASLPDHDQTSPNDTTSQTSSPPDLYPTVSPEEHYQIFPIQDSDPTHSTTAPSNRSPDP
THSTTAPSNRSPPTQPSQIPNYDLRNRAIPTDVSQIFPSLELEVWQTATSLDLSQPSISP
DLGQMALSPDPGQESLSPDLGQTSLSPDLSQESLSPDLGQTALSPDPSQESLSPDLGQTS
LSPDLGQESLSPDLGQTALSPDPSQESLSPDLGQTSLSPDLGQTALSPDPSQESLSPDLG
QTSLSPDLGQESLSPDLGQTALSPDLSLESLSPDLSQLDLKQTSPPLDLNQTSHTSESSQ
SLPLPEFGQTFPNADIGQMPSPPPDSTLNNTFKPEEFNPLVVVGLSRDDGDYIEIIPRQK
EESSEEDYGEFEFVAYNDPYQTDLRTDINSSRNPDNIAAWYLRSNTGNRKYYYIAAEEIS
WDYSKFVQSDDVDYVPEDTVYKKVVFRKYLDSTFTKLDPQGEYEEHLGILGPVIRAEVDD
VIQVRFKNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAIQPNKTYTYVWHATT
RSGPENPGSACRAWAYYSAVNPEKDIHSGLIGPLLICRKGTLDKETNMPVDMREFVLLFM
VFDEKKSWYYDKKPTRSWRRASSEVKNSHEFHAINGMIYNLPGLRMYEQEWVRLHLLNLG
GSRDIHVVHFHGQTLLENGTQQHQLGVWPLLPGSFKTLEMKASKPGWWLLDTEVGEIQRA
GMQTPFLIVDRECKMPMGLSTGLIADSQIQASEFWGYWEPKLARLNNGGSYNAWIAEKLS
TEFNPEPWIQVDMQKEVLLTGIQTQGAKHYLKPYYTTEFCVAYSLDRKNWRIFKGNSTRN
VMYFGGNSDASTIKENQIDPPVVARYIRISPTGSYNKPALRLELQGCEVN
Download sequence
Identical sequences F1N0I3
ENSBTAP00000023573 ENSBTAP00000023573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]