SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023581 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023581
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.4e-96
Family Carbonic anhydrase 0.000000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023581   Gene: ENSBTAG00000017733   Transcript: ENSBTAT00000023581
Sequence length 249
Comment pep:known chromosome:UMD3.1:14:79372712:79388600:-1 gene:ENSBTAG00000017733 transcript:ENSBTAT00000023581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSQRMVNNGHSFNVEYD
DSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHLVHWNTKYGDFG
TAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDPGSLLPNVLDYW
TYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLMLANWRPAQPLK
NRQVRGFPK
Download sequence
Identical sequences F1N0H3
ENSBTAP00000023581 ENSBTAP00000023581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]