SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023709 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023709
Domain Number 1 Region: 83-370
Classification Level Classification E-value
Superfamily L domain-like 5.87e-52
Family Ngr ectodomain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023709   Gene: ENSBTAG00000017834   Transcript: ENSBTAT00000023709
Sequence length 381
Comment pep:known_by_projection chromosome:UMD3.1:16:1041923:1055957:1 gene:ENSBTAG00000017834 transcript:ENSBTAT00000023709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSLCWLLTLLLILATAAQGQPTRRPRPRPRPRPRPRLRPTPSFPQPDEPTEPTDLPPP
LPPGPPSVFPDCPRECYCPPDFPSALYCDSRNLRKVPVIPSRIHYLYLQNNFITELPVES
FKNATGLRWINLDNNRIRKVDQRVLEKLPSLVFLYMEKNQLEEVPAALPRNLEQLRLSQN
QISRIPPGVFSKLENLLLLDLQHNKLSDGVFKPDTFQGLKNLMQLNLAHNTLRKMPPKVP
SAIHQLYLDSNRIEAIPSGYFKSFPNLAFIRLNYNQLSDRGLPKNSFNISNLLVLHLSHN
RISSVPAISSRLEHLYLNNNSIEKINGTQICPNNIVAFHDFSSDLEHVPHLRYLRLDGNY
LKPPIPLDLMMCFRLLQSVVI
Download sequence
Identical sequences F1MX63
9913.ENSBTAP00000023709 XP_005216708.1.76553 ENSBTAP00000023709 ENSBTAP00000023709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]