SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023769 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023769
Domain Number 1 Region: 48-177
Classification Level Classification E-value
Superfamily L domain-like 2.01e-24
Family Ngr ectodomain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023769   Gene: ENSBTAG00000017882   Transcript: ENSBTAT00000023769
Sequence length 257
Comment pep:known chromosome:UMD3.1:1:145885350:145887681:1 gene:ENSBTAG00000017882 transcript:ENSBTAT00000023769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPTGRQSPSSLPVPAGGPCLLLLFCLRLGASCPQNCQCPDHAGAVAVHCSARGLQEVPR
DIPADTVLLKLDANKIARIPNGAFQHLHQLRELDLSQNAIETIGPAAFSGLAGGLRLLDL
SHNRLRRIPKDALGKLSAKIRLAHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEY
VGKPLIQALDSGVSFCSVHHKTTDVAMLVTMFGWFAMVITYVVYYVRQNQEDARRHLEYL
KSLPSTPMSKDPTSSAP
Download sequence
Identical sequences A6H793 L8HWS8
ENSBTAP00000023769 ENSBTAP00000023769 NP_001092354.1.59421 NP_001092354.1.76553 9913.ENSBTAP00000023769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]