SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023840 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023840
Domain Number 1 Region: 44-272
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.85e-45
Family Alanine racemase-like, N-terminal domain 0.0000000301
Further Details:      
 
Domain Number 2 Region: 251-404
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.16e-38
Family Eukaryotic ODC-like 0.00000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023840   Gene: ENSBTAG00000017924   Transcript: ENSBTAT00000023840
Sequence length 441
Comment pep:novel chromosome:UMD3.1:21:50322855:50324578:-1 gene:ENSBTAG00000017924 transcript:ENSBTAT00000023840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFSNEFDCHFLDEGITTKDLLDQKNKGASCLITLKCIFVGSILTKKHLRWFKTLPRVT
PIFAVKCNDSRTIVKTAANGRRLDCVSKTELQLVLLGMPPVRIVYANLYKQVSQIEYNAN
NRVQMMTFDSEVELMKASRAHPKAKLVLQITTDNSKAVCHLSVKFGARLLLEWAKVLDID
VIVVNFRVGSGYTDPETFMQVISDVCCVFDIGAKVGFNMYLLDIGGGFPGSEDVKLKSEI
TSVIKPSLDKYFPSDSGVSIIPEPGRYYVASAFTLAVNIIAKKKEQTDSDDEEESSEQMY
YMNDGVYGSFNCILRITHTKPLLQKRPKPDEKYYSSSIWGPICDGLDHIVERCNLHVGNW
MLFENMGAYTATIASTFNGFQRPTMYYVMPGPTWQLMKQIQNQDFPPRAEEQDVSPLHPV
LCLESSMKQRSADCASTCINM
Download sequence
Identical sequences E1BG69
ENSBTAP00000023840 ENSBTAP00000023840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]