SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023886 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023886
Domain Number 1 Region: 51-166
Classification Level Classification E-value
Superfamily L domain-like 3.16e-23
Family U2A'-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023886   Gene: ENSBTAG00000017964   Transcript: ENSBTAT00000023886
Sequence length 192
Comment pep:known chromosome:UMD3.1:15:52492121:52508047:1 gene:ENSBTAG00000017964 transcript:ENSBTAT00000023886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRNYMNTSVQEPPLDYSFRSIHVTQDLLSEEPRTGLRPVRHAKSGKSMTQSLWLNNNV
LTDLRDFNHAVSQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEV
NKLAALPRLRSLTLHGNPIEEEKGYRQYVLCTLPHITTFDFSGVTKADRTTAEVWKRMNI
KPKKVRIKHNAL
Download sequence
Identical sequences Q5EAD8
ENSBTAP00000023886 9913.ENSBTAP00000023886 NP_001019716.1.59421 NP_001019716.1.76553 NP_001268967.1.59421 NP_001268967.1.76553 NP_001268968.1.59421 NP_001268968.1.76553 ENSBTAP00000023886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]