SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023889 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023889
Domain Number 1 Region: 279-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-38
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-18
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000305
Family B-box zinc-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023889   Gene: ENSBTAG00000034940   Transcript: ENSBTAT00000023889
Sequence length 452
Comment pep:known chromosome:UMD3.1:29:5232246:5240315:-1 gene:ENSBTAG00000034940 transcript:ENSBTAT00000023889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLQVFQSELTCSICMNCFLDPITIDCGHSFCRPCLSLCWEEGQTPRRCPECRGIAE
TPDFKTNIVLKRLVSLARQARADHDHSSEEQICVTHQEAKGFFCEADQTLLCGPCSERPE
HTAHSHSPIHRAAEESREKLLKRMGSLWKIREEMQILLNQEAKKTWSFKDYVALRKEMIT
AEYQRMLLFLREEEQLHLEALEREAKEMCEQLEESVFRMTQYRASLKEMYRELTGMCCKP
DRELLQVRKEVDARIDLAEMQKPQPVNPELTCLPVTGILDMLNNFRVDNILSQTTTIHHM
SLSEDSNDASVMFRDEHHGTSRQPQIVESVVSWGTRAFASGRHYWELDVTHSSSWILGIC
KDILITNTSINIYSEEACILFSKKVNNHYSLFTNTPPYIQYVKRPLGRIGVFLDYDNGTV
SFYDVCRGSLIYRFLPSPFSFPLKPFLCLRSP
Download sequence
Identical sequences F1MVG5
NP_001179468.1.59421 NP_001179468.1.76553 ENSBTAP00000023889 ENSBTAP00000023889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]