SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023900 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023900
Domain Number 1 Region: 280-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-43
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 4.8e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000427
Family B-box zinc-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023900   Gene: ENSBTAG00000033656   Transcript: ENSBTAT00000023900
Sequence length 451
Comment pep:novel chromosome:UMD3.1:29:5358590:5363749:1 gene:ENSBTAG00000033656 transcript:ENSBTAT00000023900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLQVFQSELTCSICTKCFLDPVTIDCGHSFCRPCLSLCWEESQTPRSCPECREIPE
WSDFKTNIALKRLASLARQARADHDHSSEEQICVTHQEAKGLFCEVDQTVLCGPCSECPE
HAAHSHSPIHRAAEESREKLVKRMRTLWKLREEMKISLNQEANKTQSFENYVALRKAMIT
VQYQRIPLLLHEDEKMHLEALEQEAKEICQQLKGSVFTMTEQAESMREMYRELTEMCHKP
DMELLQSLGSVPSCRSKSVQLHLPQPVVPEFNVWPIPGLIDWLRQFQVYIELHNERVTHH
LPVFEDLRCLLAGPDGPDVDYTPPRSIYFLSWGAESFTSGQHYWEVDVAGCCNWAIGLCN
DSWARESDMALDSKGIFLLLCIKENSQHSLFTSFPPLPQYVKKPLGQVGMFLDYDGGILS
FYDVANRSLICSFLYCSFSSPLKPFLCSRYP
Download sequence
Identical sequences G5E5K7
ENSBTAP00000023900 XP_010819101.1.76553 XP_874142.3.59421 ENSBTAP00000023900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]