SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024049 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000024049
Domain Number - Region: 64-147
Classification Level Classification E-value
Superfamily PUG domain-like 0.00523
Family PUG domain 0.017
Further Details:      
 
Domain Number - Region: 378-404,457-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024049   Gene: ENSBTAG00000018063   Transcript: ENSBTAT00000024049
Sequence length 517
Comment pep:known_by_projection chromosome:UMD3.1:13:78712288:78722796:-1 gene:ENSBTAG00000018063 transcript:ENSBTAT00000024049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKPSSMDAKYKDDLFRKYVQFHESQGDATPSSDESLRAAASTLLSLHKVDPCYRFRLIQ
FYEVVESSLRSLRSSSLRALRCAFSVLETMGINLFLCPWKKEFRSIKTYTGPFVYYVKST
LLEEDIRAILSYMGYMPELGTAYRLKELVETLQVKMVSFELFLAKVECEQMLEIHSQVKD
KGYTELDVVSERRGSVEDARGCAEALRRRAEAREPLSASMARVVLQKSASERAAKDYYKP
RVTKPSRSVDTYDSYWESRKPPLKTSLSLRKEPAAAEPGDELKDEIIRPPPSLLTVAGSP
HGGADDLPAPAPSNGLGLLRGPYLPGSDDVDLYTDAEPRAAYRRQDALRPDVWLLRNDAH
PGYHKRSTPAKESALSKCQNCGLSCSAALCQRCDSLLACSPAAKPSAFPGKASGHDSLAH
GAALREKYAGQTQGLERPPHLHSKSKPPSAVAATSRCGFCNRPGAANTCTQCSKVSCDAC
LSAYHYDPCCKKSELHKFMPNNQLNYKSTQFSHLVYR
Download sequence
Identical sequences E1BLR1
ENSBTAP00000024049 9913.ENSBTAP00000024049 NP_001179609.1.59421 NP_001179609.1.76553 XP_005214800.1.76553 XP_005214801.1.76553 XP_010809790.1.76553 XP_015329651.1.76553 ENSBTAP00000024049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]