SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024072 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024072
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.39e-51
Family NadC C-terminal domain-like 0.0000336
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.85e-25
Family NadC N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024072   Gene: ENSBTAG00000018082   Transcript: ENSBTAT00000024072
Sequence length 299
Comment pep:known chromosome:UMD3.1:25:26747355:26762056:-1 gene:ENSBTAG00000018082 transcript:ENSBTAT00000024072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEGLAHLLPPATLAALADSWLREDCPGLNYVALVSGTAPSQAVLWAKSPGVLAGRPFF
DAIFAQVNCQVSWFLPEGSKLVPVAKVAEVRGPAHCLLLGERVALNTLARCSGVASMAAA
AVETARGTGWAGHVAGTRKTTPGFRLVEKYGLLVGGAAAHRYDLGGLVMVKDNHVMAAGG
VKKAVRAARRAADFALKVEVECSSLQEAVEAAEAGADLVLLDNFRPEELHPTAATLKAQF
PSVSVEASGGVRLDNLPQFCGPHIDVISLGMLTQAAPALDFSLKLFAEGATPVPHARRS
Download sequence
Identical sequences F1MHB8
ENSBTAP00000024072 ENSBTAP00000024072 9913.ENSBTAP00000024072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]