SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024122 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024122
Domain Number 1 Region: 165-299
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-20
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 15-70,112-168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000024122
Domain Number - Region: 286-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000776
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024122   Gene: ENSBTAG00000018123   Transcript: ENSBTAT00000024122
Sequence length 448
Comment pep:known chromosome:UMD3.1:21:57153110:57246389:-1 gene:ENSBTAG00000018123 transcript:ENSBTAT00000024122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFKRILTVTVLALCLPTPGNAQQQCTNGFDLDRSSGQCLDVDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSNPYSASYPAAAPPLSAPNYPTISRPLICRFGYQMD
ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELED
DGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPAGYILLDDNRSCQDINECEHRNHTCI
LQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF
Download sequence
Identical sequences Q2KJ89
ENSBTAP00000024122 XP_005222281.1.76553 XP_005910316.1.15283 XP_014338611.1.15283 9913.ENSBTAP00000024122 ENSBTAP00000024122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]