SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024140 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024140
Domain Number 1 Region: 136-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000329
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024140   Gene: ENSBTAG00000018134   Transcript: ENSBTAT00000024140
Sequence length 247
Comment pep:known_by_projection chromosome:UMD3.1:6:91126256:91138391:1 gene:ENSBTAG00000018134 transcript:ENSBTAT00000024140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLLPPAPVVLSLLIFGSAHYTAGLDVNDTYSGKGEPFSGDHSADRFEVTSRSEISSA
SETPPGGELSSVIDYDYAEEYDNEPQISGYIVDDSVRVEQVVKPKKNKTESEKTSDKPKR
KKKGGKNGKNRRNRKKKNLCDTEFQNFCIHGKCTFLEQLETVSCQCYPEYFGERCGEKSM
KTQSMVDSDLSKIALAAIAAFVSAMTFTAIAVFITILLRRRYLRGYEGVAEERKKLRQEN
GNAHAVA
Download sequence
Identical sequences F1MEV4
ENSBTAP00000024140 ENSBTAP00000024140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]