SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024169 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024169
Domain Number 1 Region: 2848-3027
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.48e-37
Family Laminin G-like module 0.00000405
Further Details:      
 
Domain Number 2 Region: 2657-2831
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-33
Family Laminin G-like module 0.0000873
Further Details:      
 
Domain Number 3 Region: 2253-2439
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-32
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 4 Region: 2435-2629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.85e-30
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 5 Region: 2084-2253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-29
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 804-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000544
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 7 Region: 754-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1357-1408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000642
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 9 Region: 697-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000711
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 271-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000711
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 11 Region: 998-1046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 857-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 13 Region: 1415-1465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000018
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1463-1509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 15 Region: 659-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.076
Further Details:      
 
Domain Number 16 Region: 328-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 17 Region: 949-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024169   Gene: ENSBTAG00000018160   Transcript: ENSBTAT00000024169
Sequence length 3031
Comment pep:known_by_projection chromosome:UMD3.1:24:40384895:40508687:-1 gene:ENSBTAG00000018160 transcript:ENSBTAT00000024169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGMFSAPLRAQHLALAAVNGLFPAILNLASNAHISTNATCGEKGPETYCKLVEHVPGRA
MRNAQCRVCDGSSANPKAERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQV
AYVIIKAANAPRPGNWILERSVDGVKFSPWQYYAVSDTECLTHYNITPRRGPPTYRADDE
VICTSYYSRLVPLEHGEIHTSLINGRPSSDDLSPKLLDFTSARYIRLRLQRIRTLNADLM
TLSHRDPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEGTKKFQCQCEHNTCGD
RCNRCCPGYHQQPWRPGTVSSGNTCEECNCHNKAKDCYYDEDVANQRRSLNIAGQFRGGG
VCIGCLQNTMGVNCETCVDGYYRPHGVSPYEDHPCRPCDCDPVGSLNSVCIKDDLHSDLH
RGTCFISVLENVEGSHCDRCKPGFYNLEEKNPQGCSECFCFGVSDVCESLSWPVSQVKDM
SGWLVTDLVSSNQIRSQEDALGGRHQISINNSAVEQRLTSQYYWAAPEAYLGNKLTAFGG
FLKYTVSYEVPVEAVDGDPLSHADVIIKGNGITLSTQAEGLLLQPYEEYLNVVRLLPENF
RDFKSKREIDRDQLMTVLANVTHLLIRANYNSAQTALYRLDSVSLDVASPNVIDLSLATE
VEHCECPQGYAGISCESCLPGYYRVDGILFGGICQPCECHGHAAECDVHGVCFACQHNTT
GEHCERCLPGFYGLPSRGTPGDCQPCACPLSTASNNFSPTCHLDDGDEVVCDQCAPGYMG
DWCERCADGYYGNPTVPGDSCVACNCSGNVDLLEPGSCDSVTGECLRCLGNTDGPHCERC
ADGFYGDAVTAKNCRACECHGQGSLSAVCHPETGLCECKPHVTGQRCDQCLYGYYGLETG
LGCLPCNCSAGSLSDDCTPEGHCLCVPGVAGEKCDRCARGFYSYQDGGCTPCDCAHTQNT
CDPETGECVCPPHTRGAACEECADGHWGHDLELGCQACNCSSVGAASQRCDVVTGHCRCK
PAFGGRTCEQCSPGYKGFPDCMACDCDPRGTLADTCDQEQGLCSCAQETGACSCKENVAG
PQCGECRAGTFALDKADPRGCTPCFCFGLSQLCSEAQGYVRTPVTLGSDQPLLRVVSQSN
LKGTTEGVYYQAPDVLLDAVTVRQQVHAEPFYWRLPGQFQGDQLLAYGGTLRYSVAFYAS
DGIGTSNLEPQVLVKGGRTRKQVIYVDAPAPENGVRQEQEVGMTESFWKYFNSVSEEPVT
RSDFMSVLSNIEYILIKASYGQGLQQSRISNISMEVGRKAEELHAGRVVALLLEKCVCPP
GTAGLSCQDCAPGYHRGKLPEGDGRRPRPLLAPCVPCNCNNHSDTCDPETGKCLNCGHNT
TGDHCDTCAPGYYGKVTGSASDCSPCTCPHSLPASYSPTCILEGDHDFRCDACFVGYEGQ
YCERCSSGYYGNPRMPGSTCQRCDCSPHGSVHSDCDRGSGQCICRPGATGLRCGDCEPRH
ILVESDCVSCDDDCVGVLLNDLAHVGDAILSVNLTSTIPLPYGVLSDLENRTKSLRDSLL
KENTQKELVKIQLGGVSEQTEDLQRELDRVLTRSEQVTRATERILDKSVDLIKLTEKLQT
DIEEMIKKAMTLNQTLDDDVQLPSSTLQDMQENITALLEVLRKRQFLPLHQNATLELKAA
EDLLSQIQENYQKPQEELAVLKEAVSSLLSTHNRDVRAAEELLREAETKTQESSRLLLLI
GANLREFNEKKLRVQEEQNLTSALIAEGRGLLDAAAAPANASGEALAQLEQHQDELLLWT
AQIRRHVDDLVMQMSEKRALGLVYRAEDHAAELQRRAGALDSGLGNVRHVSLNATSAAHV
HSNIRSLIEESERLATDALGTVKEASAASESLVSNGRAALRRSSEFLKEGNRLSRKHRGT
TLELSRLKDTAKRFQEDADKITRQTNESLLILKAIPEGVRDRGAKVTDLAMSANQSATST
LKNVMGLSQKLLNTSTDLSRVNATLQETDELLRDSSMTTLLAGRKVKDVETQANLLLDRL
KPLKMLEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNSLTLN
VKTSEPDNLLFYLGSSTSADFLAVEMRRGKVAFLWDLGSGSTRLEFPDFPIDDNKWHGIY
VTRFGNIGSLSVKEMSAAQKPPPRTSKSPGTAKVLDVNNSTMMFVGGLGGQIKKSPAVKV
THFKGCMGEAFLNGQSIGLWNYIEREGECHGCFGSPQDEDASFHFAGSGYSVVEKTLRAT
VTQIIMLFSTYSPNGLLLYLASNGTKDFLSIDLVDGRVRVTVDLGSGPLALITDRRYNNG
TWYKIAFQRNKKQGLLAVIDAYNTTYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVV
RKGVSSKSYVGCIKNLEISRSTFDLLRNSYGVRKGCILEPVRSVSFLRGGYVELPPKSLS
PDTELLATFATRSSSGIVLAALSQSSEKPGDRQAHGPFWSIMLIEGHVEVHVNPGDGTSL
RRALLHAPTGTYGDGQEHSISMIRSGRVVTVQVDETTPVEMKLGPSAESRTINVSSLYVG
GIPEGEGTPMLKMRSSFHGCIRNLVFNMELLDFTSAADYEHADLDSCSLSGRPKLAVYRE
DGERPPEPQPLPSPELCATERAPEYIPNAHQFGLAEGSHLVLPFNQLAVRKRLSVQLRIR
TFASSGLVFYMAHQNQVDHAALQLHAGRLHFTFDLGKGRTKVSHPALLSDGQWHTVKTEY
FKRRGFMTVDGQESPVVTTVGDATTLDVEGKLYLGGLPSEYRARNTGNITHSVPACLGEV
TVNSQQLHMDIPMSAFAVTRCYAVAQEGTFFEGSGYAALVREGYRVRSDVNITLEFRTSS
ENGVLLGISSAKVDAIGLEIVDGKLLFHVNNGAGRITATYEPKTPSRLCDGRWHTLQANK
SKHRVVLTVDGNVVRAESPHTQSTSADTSDPIYVGGYPADVKQNCLSSRTSFRGCVRRLT
LTKGPQVQSFDFSTAFDLQGVFPHSCPGTES
Download sequence
Identical sequences F1MEG3
ENSBTAP00000024169 ENSBTAP00000024169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]