SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024223 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024223
Domain Number 1 Region: 473-765
Classification Level Classification E-value
Superfamily L domain-like 3.06e-48
Family Ngr ectodomain-like 0.062
Further Details:      
 
Domain Number 2 Region: 33-257
Classification Level Classification E-value
Superfamily L domain-like 2.45e-31
Family Ngr ectodomain-like 0.0068
Further Details:      
 
Domain Number 3 Region: 191-428
Classification Level Classification E-value
Superfamily L domain-like 2.04e-29
Family Ngr ectodomain-like 0.067
Further Details:      
 
Domain Number 4 Region: 859-1013
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.07e-25
Family Toll/Interleukin receptor TIR domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024223   Gene: ENSBTAG00000018198   Transcript: ENSBTAT00000024223
Sequence length 1029
Comment pep:known chromosome:UMD3.1:22:49229610:49233939:1 gene:ENSBTAG00000018198 transcript:ENSBTAT00000024223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPYCAPHPLSLLVQAAALAAALAEGTLPAFLPCELQPHGQVDCNWLFLKSVPHFSAGAP
RANVTSLSLISNRIHHLHDSDFVHLSNLRVLNLKWNCPPAGLSPMHFPCRMTIEPNTFLA
VPTLEELNLSYNGITTVPALPSSLVSLSLSHTSILVLGPTHFTGLHALRFLYMDGNCYYM
NPCPRALEVAPGALLGLGNLTHLSLKYNNLTEVPRRLPPSLDTLLLSYNHIVTLAPEDLA
NLTALRVLDVGGNCRRCDHARNPCRECPKNFPKLHPDTFSHLSRLEGLVLKDSSLYKLEK
DWFRGLGRLQVLDLSENFLYDYITKTTIFNDLTQLRRLNLSFNYHKKVSFAHLHLASSFG
SLVSLEKLDMHGIFFRSLTNITLQPLTRLPKLQSLRLQLNFINQAQLSIFGAFPSLLFVD
LSDNRISGAATPAAALGEVDSRVEVWRLPRGLAPGPLDAVSSKDFMPSCNLNFTLDLSRN
NLVTIQQEMFTRLSRLQCLRLSHNSISQAVNGSQFVPLTSLRVLDLSHNKLDLYHGRSFT
ELPQLEALDLSYNSQPFSMQGVGHNLSFVAQLPSLRYLSLAHNGIHSRVSQKLSSASLRA
LDFSGNSLSQMWAEGDLYLCFFKGLRNLVQLDLSENHLHTLLPRHLDNLPKSLRQLRLRD
NNLAFFNWSSLTVLPRLEALDLAGNQLKALSNGSLPPGIRLQKLDVSSNSIGFVIPGFFV
RATRLIELNLSANALKTVDPSWFGSLAGTLKILDVSANPLHCACGAAFVDFLLERQEAVP
GLSRRVTCGSPGQLQGRSIFTQDLRLCLDETLSLDCFGLSLLMVALGLAVPMLHHLCGWD
LWYCFHLCLAHLPRRRRQRGEDTLLYDAFVVFDKVQSAVADWVYNELRVQLEERRGRRAL
RLCLEERDWLPGKTLFENLWASVYSSRKTMFVLDHTDRVSGLLRASFLLAQQRLLEDRKD
VVVLVILRPAAYRSRYVRLRQRLCRQSVLLWPHQPSGQGSFWANLGIALTRDNRHFYNRN
FCRGPTTAE
Download sequence
Identical sequences A5H631 A5H634
9913.ENSBTAP00000024223 ENSBTAP00000024223 ENSBTAP00000024223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]