SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024242 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024242
Domain Number 1 Region: 51-290
Classification Level Classification E-value
Superfamily L domain-like 1.25e-25
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 2 Region: 337-422
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-16
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024242   Gene: ENSBTAG00000018213   Transcript: ENSBTAT00000024242
Sequence length 424
Comment pep:known chromosome:UMD3.1:15:32206559:32249122:1 gene:ENSBTAG00000018213 transcript:ENSBTAT00000024242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERT
CAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYETVSCPSICCHSLKLLH
ITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQ
SWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDS
ERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIR
LDQTVAELKKQLKTLVQLPTSNMLLYYLDHEAPFGPEEMKYSSRALHSFGIRDGDKIFVE
SKTK
Download sequence
Identical sequences F1MCE2 L8IGG1
ENSBTAP00000024242 ENSBTAP00000024242 9913.ENSBTAP00000024242 NP_001192382.1.59421 NP_001192382.1.76553 XP_005216108.1.76553 XP_005216109.1.76553 XP_005216110.1.76553 XP_005897166.1.15283 XP_005897167.1.15283 XP_010810812.1.76553 XP_010828791.1.44457 XP_010828792.1.44457 XP_010828793.1.44457 XP_010828794.1.44457 XP_010828795.1.44457 XP_010828796.1.44457 XP_019830977.1.53367 XP_019830978.1.53367 XP_019830979.1.53367 XP_019830980.1.53367 XP_019830981.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]