SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024358 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024358
Domain Number 1 Region: 257-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.82e-29
Family Laminin G-like module 0.06
Further Details:      
 
Domain Number 2 Region: 1524-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 688-767,797-813
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000702
Family Zinc protease 0.079
Further Details:      
 
Domain Number 4 Region: 1590-1647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000417
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Domain Number 5 Region: 536-635,720-771
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000157
Family Zinc protease 0.079
Further Details:      
 
Domain Number 6 Region: 1480-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000278
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Domain Number 7 Region: 841-895,1063-1106
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000577
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024358   Gene: ENSBTAG00000018303   Transcript: ENSBTAT00000024358
Sequence length 1791
Comment pep:known_by_projection chromosome:UMD3.1:16:59132781:59456250:1 gene:ENSBTAG00000018303 transcript:ENSBTAT00000024358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCFKILRVSLVVLAGWALSTVSSELGWTRKRSLAQRGHLSQVLSEGEHCWLGAKVRRPR
VAPQHHLFGVYPSLPGDYLRPYPAGDQGRNHAECSEQDAEGMAVSSVPPDPTASARMRSE
AERPAAPWGGDSPIGQSELLGDDDTYLGDGGSKEPVGEAGTLEGTASAATMITTFPCPGE
SGPETQRKGQTKTRRRRQVVKGQAGGLWGDPKFAPQHFQLWPKHPLTPRVRTGPSESGIR
NGGGDPSWEAETVSPQGRLPVLYFSGRREPLLLRPEVLADIPREAFTVEAWVRPEGGQNS
PAIIAGVFDNCSHAISDKGWALGIRSGKDVGRRDARFFFSLRTDRVKKATTVMGHSRYQP
GKWTHVAATYDGQRMALYVDGTQVASSPDQSGPLNSPFMASCRSLLLGGDSSEDGHSFRG
HLGILVFWSTARSQSHLQHSPQQPMEVEDLTTLLLTASFEPLEEQWVPFRDGKYPRLEVL
QGFESEPEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKVIRYRLVNIYDDEGLNPT
VSEEQIRRQHEVLNDAFSRYNISWQLSVHRVQNSTLRHRIVLLNCEPSKIGNDHCDPECE
HPLTGYDGGDCRLRGRCYPWNRKDGRCHVGCNNMLNDFDEGDCCDPDVAEVRKTCFDPDS
PRRAYMSVKELKEALQLNSTHFLNVYFGNSVREDLAGAATWPWDKEAISHLGGVVLNPAY
YGMPGHTNIMVHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPKSK
LCQNPEPANDTCGFTHFPGAPFNNYMSYTDDDCTDNFTPNQVARMHCYLDLVYQQWSQSQ
KPTPIPIPPMVIGQTQKSLTIHWLPPISGVMYDRAPGSVCGACTEDGTFRQYVHTASSQR
VCDSSGYWTPEEAVGPPDVDRPCEPSLQAWSPELHLYHMNMTVPCPTEGCSLELLFQHPV
QADTLTLWVTYLSMGSSPVLFDTEILLEHQKSVHLGPLDTFCDTPLTIKLHVDGKVMGVK
VYTFDERMEIDAALLTSQPHSPLCSGCRPVKYQVLREPPFASGLPVVVTHPLRKFTDTEV
MPGQMYRYQVQAAAGAELGEASPPLSHIHGAPYCGDGKVARNLGEECDDGDLLNGDGCSR
ACELEEGFNCVGEPSLCYIHEGDGICEPFEKETSIVDCGLYTPKGYLDQWATQAFSSHED
KKKCPASLVTGAPHSMVCTSYRPDLPEHRPIIGWFPCVPSGNGPEDEGSKQPKGSLQRED
EVWLKVCFNRPGVATAIFIFLTSDGLVPGKRQRPTVTLYLTDVSGNNHSLGTYELSCQHN
PLVINITHHSNVLFHHATSVLLNFSTPLVGISAVALRTPSDISPSAPNSCIIPEHKGQNH
QGQSCVHRPCGEQGNCVPLVLDHADVVNCTSGGPGHMKCSITCQRGFALQASNGRYLRPI
QKEILLTCSSGHWDWVVSCQPLDCGVPDASLVNYAKFSCSEGTNFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEAYCKLECDAPPVIPNANLLQPRCLKGNHDVGSTCRYECKPGY
YVMGSTENKVRKKSLKIQCLESGIWEQGSCVPVVCKPPSPVFEGMYECTNGFELNSQCLV
KCNQESKRLPIRCTKEGVWSEEFKLCENLQGECPPPTSEPKLVEYKCEQGYGIGAVCSPL
CTVLPNDPVILPENVTTDTLEHWMEPVRVQSIMCTGRRQWHPDPLLIHCIQSCEPFQGDG
WCDTINNRAYCNYDGGDCCPSTLSSKKVIPFAADCDQDECTCRDPRAEENL
Download sequence
Identical sequences E1BF00
ENSBTAP00000024358 XP_010811788.1.76553 XP_015322404.1.59421 ENSBTAP00000024358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]