SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024473 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024473
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.63e-32
Family Ribosomal L11/L12e N-terminal domain 0.00000984
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.7e-17
Family Ribosomal protein L11, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024473   Gene: ENSBTAG00000027878   Transcript: ENSBTAT00000024473
Sequence length 165
Comment pep:novel chromosome:UMD3.1:7:6445374:6445871:-1 gene:ENSBTAG00000027878 transcript:ENSBTAT00000024473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKLDPNEIKVVYLRCTGGEVGAMSVLAPKIGPLGLSPKKVGDDIAKATGGWKGLRITV
KLTIQNRQAQIEVVPSASTLIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIAWQMQHRS
LARELSGTIKEILGTAQSVGCNVDGRHPYDIIDGINSGAVECPAS
Download sequence
Identical sequences F1MDX5
ENSBTAP00000024473 ENSBTAP00000024473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]