SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024496 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000024496
Domain Number - Region: 62-97
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 0.0432
Family Initiation factor IF2/eIF5b, domain 3 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024496   Gene: ENSBTAG00000018410   Transcript: ENSBTAT00000024496
Sequence length 206
Comment pep:known chromosome:UMD3.1:12:19298916:19328161:-1 gene:ENSBTAG00000018410 transcript:ENSBTAT00000024496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAGGELGAAAGGSLLLCASLLAVGCALGLRLGRGRGAADRGLLAWLCFNALVHFALEGP
YVYLSMVGNITHSDALIASLWKEYGKADARWLYFDPTIVSVEILTVVLGGSLALVLVYAI
VKEKHYRHFVQITLCVCELYGGWMTFCPDWLMGSPNLNTNSWLYFWVYLVFFNGVWVLIP
GLLLWQSWVELKKMHHKGSNSRKKFQ
Download sequence
Identical sequences E1BCB3
NP_001192668.1.59421 NP_001192668.1.76553 ENSBTAP00000024496 9913.ENSBTAP00000024496 ENSBTAP00000024496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]