SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024549 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024549
Domain Number 1 Region: 575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.49e-49
Family Phosphate binding protein-like 0.0000329
Further Details:      
 
Domain Number 2 Region: 126-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.33e-23
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024549   Gene: ENSBTAG00000018445   Transcript: ENSBTAT00000024549
Sequence length 1137
Comment pep:known_by_projection chromosome:UMD3.1:8:92945058:93145524:-1 gene:ENSBTAG00000018445 transcript:ENSBTAT00000024549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPPPCALVLAGVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRTPDGSRTGAPRDEPEPGTWLPPAPSPGARWLGSALHGRGPPGARKPGEGARAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSLGEMMELDLVSSVLHIPVISIVRYEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITIN
LSSTEDLLSFLQVQLESIKNSTPTMVMFGCDMESIRRIFEITTQFGVMLPELRWVLGDSQ
NVEKLRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTVNCM
DVETANLTSGQYLSRFLANTTFRGLSGSIKVKGSTIISSENNFFIWNLQNDPMGKPMWTR
LGSWQRGKIVMDYGIWPEQAQRHKTHFQHPSKLNLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSAMLDSLFSSLHSSNDTVPIKLKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLSGSAHLAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRSKVFSFSSAL
NVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATLDGVAYLKNDPEKLD
AFIMDKALLDYEVSVDADCKLLTVGKPFAIEGYGIGLPPNSPFTSNISELISQYKSHGFM
DVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFMLLCIGFGLSILTTIGEHMVYRLLL
PRIKNKSRLQYWLHTSQRLHRALNTSFVEEKQQRFKTKRVEKRDCWSPLLCNLHGACQNH
FRFPRSSVGPRHLTVWNTSNLSHDNRRKYIFNDEGGPNQLGVRTHQDIPLPPRRRELPAS
LTTNGKADSHSGARNSVIQELSELERQIQVIRQELQLAVSRKTELEEYQRTNRTCEP
Download sequence
Identical sequences E1BK87
ENSBTAP00000024549 ENSBTAP00000024549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]