SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024584 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024584
Domain Number 1 Region: 33-519
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-143
Family ALDH-like 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024584   Gene: ENSBTAG00000018469   Transcript: ENSBTAT00000024584
Sequence length 537
Comment pep:known_by_projection chromosome:UMD3.1:10:85821883:85839587:-1 gene:ENSBTAG00000018469 transcript:ENSBTAT00000024584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAVAAAAAALRARILQVSSKVNSSWQPASSFSSSSVPTVKLFIDGKFIESKSDKWID
IHNPATNEVIGRVPESTKAEMDAAVSSCKRTFPAWADTSILSRQQVLLRYQQLIKENLKE
IARLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGV
CAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLFQDSGAPDGTLNII
HGQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANK
ENTLNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVERAKKLRVNAGDQPGADLGPL
ITPQAKERVCNLIDSGTKEGASILLDGRSIKVKGYENGNFVGPTIISNVKPNMTCYKEEI
FGPVLVVLETDTLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVP
LPMFSFTGSRASFRGDTNFYGKQGIQFYTQLKTITSQWKEEDASLSSPAVVMPTMGR
Download sequence
Identical sequences F1N7K8
XP_005893863.1.15283 9913.ENSBTAP00000024584 ENSBTAP00000024584 ENSBTAP00000024584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]