SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024658 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024658
Domain Number 1 Region: 281-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-60
Family SPRY domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily RING/U-box 1.44e-19
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 85-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024658   Gene: ENSBTAG00000018523   Transcript: ENSBTAT00000024658
Sequence length 460
Comment pep:known chromosome:UMD3.1:23:31693732:31708621:-1 gene:ENSBTAG00000018523 transcript:ENSBTAT00000024658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKKMREEATCSICLHLMTNAVSISCGHSYCHVCIVSFFENLNRMTPGLKTFSCPQCRA
PFTMASLRPNKQLGNLIEVIKEMDQEMSCEEHGEKLHLFCEDEGQLICWLCDRGAQHKGH
ATALVEEACQGYKEKLQQAVTKLRQLEEECMNLKVFTAEQITKWNEKIEFQKQKIQSDFK
TLQRFLHEEEKSYLWKLEKEKEQTLRRLRDNEANLEQKNHELQSHILELENKCQGSAQKL
LQDVKDTLSRSWAVKLEQPEALSLDLHTVCNVSELYFDVKKMLRRHQVSVTLDPETAHYE
LILSEDRRQVIRGCPQENLDNSSRRFSALPCILGYEGFTSGKHYFEVDVGEGTGWDLGVC
MENVQRDTVMPQTPQSGFWAIRRCKEGYVALTSPLTSIHLTEKPLVVGIFLDFEAGVVSF
YNMTTGSHIFTFPKASFSDTLRPYFQVYLYSPLFLPPPDE
Download sequence
Identical sequences Q58DK8
ENSBTAP00000024658 NP_001029746.1.59421 NP_001029746.1.76553 XP_010816785.1.76553 XP_015315443.1.76553 ENSBTAP00000024658 9913.ENSBTAP00000024658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]