SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024750 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024750
Domain Number 1 Region: 883-1175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.11e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000013
Further Details:      
 
Domain Number 2 Region: 214-357
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-33
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-212
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-27
Family Second domain of FERM 0.00036
Further Details:      
 
Domain Number 4 Region: 19-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-18
Family First domain of FERM 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024750   Gene: ENSBTAG00000018596   Transcript: ENSBTAT00000024750
Sequence length 1180
Comment pep:known_by_projection chromosome:UMD3.1:10:101237134:101308928:-1 gene:ENSBTAG00000018596 transcript:ENSBTAT00000024750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELREIT
YFSLWYYNKQNQRRWVDLEKPLKKQLDKHALEPTVYFGVVFYVPSVSQLQQEITSRYQYY
LQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALLPVEWLQDEKVL
EEATQKVALLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGV
FVKHKSGRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVARH
KFYRLNQCSLQTQTVIVNPVRRRSSSRMSLPKPQPYAMAAPPQLHYNGHYTEPYTSSLDN
LFVTNQNGFYGHSQTSLDRAQVELGGRVRNGSVYSAHSTSSLNSPQPYLQPSPGSSNPSI
TGSDVLRPDYVPSHRHSALIPPSYRPTPDYETVMKQLQRGLAPAERQSRSLRNLSLVYSQ
PEIREHARPGSPPMAPCAFSLSHSFHSPAPYPYASAAGRRPGLGAVSVPELTNAQLQARD
CPAPSILRTQVYRPPPPYPHPRPANSTPDLSRQPPISSSNPDLITRRVHHSVQTFQEDSL
PVAHSLQEVSEPLTAARRARLQKRNSVELAGLAHGLEGLRLQERAAPALAAGERALRAED
CAAGLRGSLRGGHGKSLSDATVLIHSSDEDEDEDPEEGPAPPLGSRGGRPPDASHAAPLA
PGPLHILEPQAPGAAPGEGPRPRRDGLLSPSASESDLTTSGRYRARRDSLQKRPASDLLS
AKKNAVEGLPPLGAASPRPKTRAPQMSLKERLSQLRAQGRPLTQLFYAKWFILGHKMINM
NLEGMKKSRGDAKKIGPLKLAALNGLSLSRLPLPDEEKDVPARATNDERCKILEQRLEQG
MVFTEYERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINAS
HIKVSVSGIEWDYIATQGPLQNTCPDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRL
GSRHNTVTYGRFKITTRFRTDSGCYATTGLKMKHLLSGQERTIWHLQYTDWPEHGCPEDL
KGFLSYLEEIQSVRRHTNSASEPQSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEAL
DVPRVLDMLRRQRMLMVQTLCQYTFVYRVLIQFLRSSRLI
Download sequence
Identical sequences F1MRH9
ENSBTAP00000024750 ENSBTAP00000024750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]