SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024762 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024762
Domain Number 1 Region: 9-137
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-20
Family Laminin G-like module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024762   Gene: ENSBTAG00000018607   Transcript: ENSBTAT00000024762
Sequence length 577
Comment pep:known chromosome:UMD3.1:1:145940972:145973811:-1 gene:ENSBTAG00000018607 transcript:ENSBTAT00000024762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHPPPLLQKNEYLLAVVAEERDSLLLGLRYSPTQLHFLFLSEDGAGAWQTRVSFRSPALV
DGQWHVLVLAVSEGSFSLTTDCGPAVDIMADMPFPATLSVRGARFFIGSRRRTKGRFTGL
VRQLVLLPGSDATPRLCPCVNPELAVLSIPAILHGLTGKPEDNEVLKYPYETNMKVTLGP
RPPCTKAEDAQFWFDASRKGLYLCVGSEWVSVLAEAKEKLDYVEEHQSLFTNSETLGIEV
FVIPEAGLFVATANRKTTSAIYKWTDGKFASYQNIPTHQAQSWRHFTIGKKIFLAVANFE
PNEKGQEFSVIYKWSQRRLRFTPYQRVPTHSARDWEAFEVAGEHFLAVANHREGDNHNID
SVIYKWNPGTRLFEANQTIATSGAYDWEFFTVGPYAFLAVANAFNGTSTRLQSHLYVRLD
GSFQLFQSFLTFGAADWEVFHIGERVFLAVANSHRYDVEMRVQNDSYVINSVIYELNVTA
QTFVRFQEIRTCSALDWEFFSVGEDYFLVVANSFDGNTFSVNSIIYRWQGYEGFVAVHSL
PTFGCRDWEAFRTAAGSFLVYSSAKEPLSRVLKLRTG
Download sequence
Identical sequences F1MRC9
ENSBTAP00000024762 ENSBTAP00000024762 9913.ENSBTAP00000024762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]