SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024852 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024852
Domain Number 1 Region: 280-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-62
Family SPRY domain 0.00000864
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 2.33e-22
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 82-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000011
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024852   Gene: ENSBTAG00000039246   Transcript: ENSBTAT00000024852
Sequence length 468
Comment pep:known chromosome:UMD3.1:7:2547175:2555050:1 gene:ENSBTAG00000039246 transcript:ENSBTAT00000024852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELF
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKSKLEKSLEHLRKQMEDALLFQAQAEETCSLWQKMVETQRQNVLT
EFERLRRLLVEEEQLLLQRLEEEELEVLPPLRESAARLGQQSAQLAELITELEGRCQLPA
LGLLQDIRDTLRRVQDVKLQPPEVVPMEMRTVCRVPGLVEALRRFRGDMTLDPDTANPEL
VLSEDRRSVRRGDLRQALPDSPERFDPGPCVLGREPLTSGRHYWEVEVGERASWALGVCR
ENANRKEKGELFAGNGFWILVFLGSYYNSSERAFAPLRDPPRRVGIFLDYEAGHLSFYSA
NDGSLLYTFPETPFSGTLRALFSPLSSSPTPMTICRLKGGPGDGLAPQ
Download sequence
Identical sequences A0JN74
NP_001071388.1.59421 NP_001071388.1.76553 XP_005893952.1.15283 ENSBTAP00000024852 9913.ENSBTAP00000024852 ENSBTAP00000024852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]