SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024853 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024853
Domain Number 1 Region: 288-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-48
Family SPRY domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 4.54e-21
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 90-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.56e-19
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024853   Gene: ENSBTAG00000018673   Transcript: ENSBTAT00000024853
Sequence length 476
Comment pep:known chromosome:UMD3.1:7:2540995:2546082:1 gene:ENSBTAG00000018673 transcript:ENSBTAT00000024853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRECIQLTWEKARGQKKRRKRKGSF
PCPECRELSPQRNLRPNRLLTKVAEMVRQHPSPQSRDLCQVHRELLKLFCEDDQRPICII
CRESQEHRPHRVVPIEEAVQEYKLKLEEDMEHLREEMTKTEELQAKEEHTLAEWQMRTQD
PRKAMVFTEFLPMGLFLMEEKQRLLQALKKEEEETVAKLQESTASLKQQSHSLERLLLQL
EDRNEHTPLQMLQDMKGLLSRKSSLSVQYPEATSIMLKTICRVPGQIEVLKSFQEDVVPD
PSTAYPYLLLYESRQRRYLSTPMDGTPCGKDRFLAYPCAVGQEIYSSGRHYWEVGMNLTG
DALWALGVCRDNVSRRNRVPKSPENGFWVVQLCKGKRYAPAAFTPTPVTLAEPPSHMGIF
LDFEAGELAFYNANDGSHLHSYSQPAFPGPLQPFFCLGAPKSGQMVISTVTLWVKG
Download sequence
Identical sequences F1MRB0
ENSBTAP00000024853 ENSBTAP00000024853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]